DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and lrit1a

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_001018174.2 Gene:lrit1a / 553943 ZFINID:ZDB-GENE-040924-5 Length:643 Species:Danio rerio


Alignment Length:400 Identity:95/400 - (23%)
Similarity:155/400 - (38%) Gaps:77/400 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LHLHLLLWLLCCCSQLGQLRAECPAVCECKWK-----SGKESVLCLNANLTHIPQPLDAGTQLLD 116
            :.|.:.|.||........:|:.||..|.|.:.     |...||:|.:..::.:|......|..|.
Zfish     1 MSLTVFLGLLLASGGFPLVRSTCPTQCSCFYHNLSDGSRARSVICNDPEISLVPASFPGDTSKLR 65

  Fly   117 LSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALY 181
            :....|:.||.::|  :.|.||:.::::...|..:...:||.|.:|.||.|..|.||:.|..:|.
Zfish    66 IEKTAIKRIPSEAF--SYLSNLEFLWMSFNVLSSLNSDSFRGLYSLEELRLDGNSLSSFPWESLM 128

  Fly   182 HVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRL---------SHIAVRAFAGLESSLEW 237
            .:..||.|.:..|.:..:|.:|..::..:..|:||...|         :.:.::...|.|||   
Zfish   129 DMPSLRLLDIHNNQLSSLPSEAALYMKNITYLDLSSNNLLTVPAEVLNTWLTIKPTLGAESS--- 190

  Fly   238 LKLDGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQQNIPSGIPPT---CESPP 299
             ||               :..||.     |.|.|.|.|..|..:....::......|   |..|.
Zfish   191 -KL---------------ILGLHD-----NPWLCDCRLYDLVQFQKSPSLSVAFIDTRLRCADPE 234

  Fly   300 RLSGRAWDKLDVDDFACV-PQIVATDTTAHGVEGRNITMSCYVEGVPQPAVKWLLKNRLIANLSA 363
            .|||..:.  |.:...|. |::...........|.|:.:.|...|||.|.:.|            
Zfish   235 SLSGVLFS--DAELRRCQGPRVHTAVARVRSAVGNNVLLRCGTVGVPIPELAW------------ 285

  Fly   364 GGDGDSDSEPRTAAATQGRKTYVVNMLRNA------SNLTILTADMQDAGIYTCAAENKAGKVEA 422
               ..:|.:|.....          :|.|:      |.|::.....:|.|.|.|.|.|.||..||
Zfish   286 ---RRADGKPLNGTV----------LLENSKEGIVWSILSVPAVSYRDTGKYICKATNYAGSAEA 337

  Fly   423 SVTLAVSRRP 432
            .::|.::..|
Zfish   338 VISLIINDAP 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 40/165 (24%)
leucine-rich repeat 112..137 CDD:275380 7/24 (29%)
LRR_8 137..196 CDD:290566 19/58 (33%)
leucine-rich repeat 138..161 CDD:275380 5/22 (23%)
leucine-rich repeat 162..185 CDD:275380 9/22 (41%)
LRR_8 184..245 CDD:290566 16/69 (23%)
leucine-rich repeat 186..209 CDD:275380 6/22 (27%)
leucine-rich repeat 210..234 CDD:275380 6/32 (19%)
leucine-rich repeat 235..258 CDD:275380 2/22 (9%)
LRRCT 267..316 CDD:214507 13/51 (25%)
IG_like 328..428 CDD:214653 25/105 (24%)
Ig 335..425 CDD:143165 22/95 (23%)
lrit1aNP_001018174.2 leucine-rich repeat 61..84 CDD:275378 7/24 (29%)
LRR_8 63..119 CDD:290566 17/57 (30%)
LRR_RI <77..175 CDD:238064 27/99 (27%)
leucine-rich repeat 85..108 CDD:275378 5/22 (23%)
LRR_8 108..167 CDD:290566 18/58 (31%)
leucine-rich repeat 109..132 CDD:275378 9/22 (41%)
leucine-rich repeat 133..156 CDD:275378 6/22 (27%)
leucine-rich repeat 157..170 CDD:275378 4/12 (33%)
LRRCT 199..243 CDD:214507 12/45 (27%)
I-set 252..343 CDD:254352 26/115 (23%)
Ig 259..333 CDD:299845 20/98 (20%)
fn3 448..515 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.