DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and LGI2

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_060646.2 Gene:LGI2 / 55203 HGNCID:18710 Length:545 Species:Homo sapiens


Alignment Length:329 Identity:72/329 - (21%)
Similarity:112/329 - (34%) Gaps:127/329 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LHLLLWLLCCCSQLGQLR--AECPAVCECKWKSGKESVLCLNAN--------------------- 100
            |.|||...|...:..|:|  |.|||.|.|.    |||::|:.::                     
Human    14 LLLLLGAACLIPRSAQVRRLARCPATCSCT----KESIICVGSSWVPRIVPGDISSLSLVNGTFS 74

  Fly   101 ------LTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKL 159
                  .:|:|     ..|||.|:.|...:|.||:|  |.|.:|:.:::....:..|.|:|||.|
Human    75 EIKDRMFSHLP-----SLQLLLLNSNSFTIIRDDAF--AGLFHLEYLFIEGNKIETISRNAFRGL 132

  Fly   160 INLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIA 224
            .:|..|.|:.|.:.|:|......:..|.||.|.||                 |.| .||:...:.
Human   133 RDLTHLSLANNHIKALPRDVFSDLDSLIELDLRGN-----------------KFE-CDCKAKWLY 179

  Fly   225 VRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQQNIPS 289
            :           |||:..:.:|:|                                         
Human   180 L-----------WLKMTNSTVSDV----------------------------------------- 192

  Fly   290 GIPPTCESPPRLSGRAWDKLDVDDFACVPQIVATDTTAH--------GVEGRNITMSCYVEGVPQ 346
                .|..||....:..:.:...|:.|    ..||...|        .|:..|.....|| .:.|
Human   193 ----LCIGPPEYQEKKLNDVTSFDYEC----TTTDFVVHQTLPYQSVSVDTFNSKNDVYV-AIAQ 248

  Fly   347 PAVK 350
            |:::
Human   249 PSME 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 39/156 (25%)
leucine-rich repeat 112..137 CDD:275380 11/24 (46%)
LRR_8 137..196 CDD:290566 19/58 (33%)
leucine-rich repeat 138..161 CDD:275380 7/22 (32%)
leucine-rich repeat 162..185 CDD:275380 6/22 (27%)
LRR_8 184..245 CDD:290566 13/60 (22%)
leucine-rich repeat 186..209 CDD:275380 6/22 (27%)
leucine-rich repeat 210..234 CDD:275380 4/23 (17%)
leucine-rich repeat 235..258 CDD:275380 5/22 (23%)
LRRCT 267..316 CDD:214507 4/48 (8%)
IG_like 328..428 CDD:214653 7/31 (23%)
Ig 335..425 CDD:143165 4/16 (25%)
LGI2NP_060646.2 LRR 1 86..107 9/22 (41%)
LRR_8 110..169 CDD:404697 19/75 (25%)
LRR 2 110..131 5/20 (25%)
leucine-rich repeat 111..134 CDD:275378 7/22 (32%)
LRR 3 134..155 6/20 (30%)
leucine-rich repeat 135..158 CDD:275378 6/22 (27%)
PCC 140..>215 CDD:188093 23/148 (16%)
leucine-rich repeat 159..171 CDD:275378 8/29 (28%)
EAR 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 219..261 8/35 (23%)
EPTP 219..258 CDD:397689 8/35 (23%)
EAR 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 265..307
EPTP 266..304 CDD:397689
EAR 3. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 311..358
EPTP 311..355 CDD:397689
EAR 4. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 360..403
EAR 5. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 407..450
EPTP 407..447 CDD:397689
EAR 6. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 452..494
EPTP 452..491 CDD:397689
EAR 7. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 498..540
EPTP 499..537 CDD:397689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.