Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001032440.1 | Gene: | Lrrn1 / 500280 | RGDID: | 1564145 | Length: | 716 | Species: | Rattus norvegicus |
Alignment Length: | 517 | Identity: | 103/517 - (19%) |
---|---|---|---|
Similarity: | 169/517 - (32%) | Gaps: | 189/517 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 LRAECPAVCECK---WKSGKE------SVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDD-- 128
Fly 129 -------------------------------------------SFATAQLLNLQKVYLARCHLRL 150
Fly 151 IERHAFRKLINLVELDLSQNLLSAI---------------------------------------- 175
Fly 176 --------------------------------PSLALYHVSELRELRLSGNPILRVPDD------ 202
Fly 203 -------------------AFGHVPQLVKLE-LSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSE 247
Fly 248 VRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQQNIPSGIPPTCESPPRLSGRAWDKLDVD 312
Fly 313 DFA--CVPQIVATDTTAHGVE---GRNITMSCYVEGVPQPAVKWLLKNRLIANLSAGGDGDSDSE 372
Fly 373 PRTAAATQGRKTYVVNM-----LRNASNLTILTADMQDAGIYTCAAENKAGKVEASVTLAVS 429 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 56/299 (19%) |
leucine-rich repeat | 112..137 | CDD:275380 | 8/69 (12%) | ||
LRR_8 | 137..196 | CDD:290566 | 24/130 (18%) | ||
leucine-rich repeat | 138..161 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 162..185 | CDD:275380 | 11/94 (12%) | ||
LRR_8 | 184..245 | CDD:290566 | 22/86 (26%) | ||
leucine-rich repeat | 186..209 | CDD:275380 | 7/47 (15%) | ||
leucine-rich repeat | 210..234 | CDD:275380 | 9/24 (38%) | ||
leucine-rich repeat | 235..258 | CDD:275380 | 10/22 (45%) | ||
LRRCT | 267..316 | CDD:214507 | 8/50 (16%) | ||
IG_like | 328..428 | CDD:214653 | 20/107 (19%) | ||
Ig | 335..425 | CDD:143165 | 18/94 (19%) | ||
Lrrn1 | NP_001032440.1 | leucine-rich repeat | 54..73 | CDD:275380 | 7/18 (39%) |
LRR | <68..372 | CDD:227223 | 57/304 (19%) | ||
LRR 1 | 73..95 | 7/21 (33%) | |||
leucine-rich repeat | 74..96 | CDD:275380 | 7/21 (33%) | ||
LRR 2 | 96..117 | 0/20 (0%) | |||
leucine-rich repeat | 97..120 | CDD:275380 | 0/22 (0%) | ||
LRR 3 | 120..141 | 0/20 (0%) | |||
leucine-rich repeat | 121..144 | CDD:275380 | 1/22 (5%) | ||
LRR 4 | 144..165 | 7/20 (35%) | |||
leucine-rich repeat | 145..168 | CDD:275380 | 7/22 (32%) | ||
LRR 5 | 168..189 | 7/20 (35%) | |||
leucine-rich repeat | 169..192 | CDD:275380 | 6/22 (27%) | ||
LRR 6 | 192..213 | 0/20 (0%) | |||
leucine-rich repeat | 193..216 | CDD:275380 | 0/22 (0%) | ||
LRR 7 | 216..237 | 0/20 (0%) | |||
leucine-rich repeat | 217..240 | CDD:275380 | 0/22 (0%) | ||
LRR 8 | 240..261 | 4/20 (20%) | |||
leucine-rich repeat | 241..264 | CDD:275380 | 5/22 (23%) | ||
LRR 9 | 264..285 | 6/20 (30%) | |||
leucine-rich repeat | 265..288 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 289..313 | CDD:275380 | 1/23 (4%) | ||
leucine-rich repeat | 314..335 | CDD:275380 | 9/20 (45%) | ||
leucine-rich repeat | 339..362 | CDD:275378 | 10/22 (45%) | ||
leucine-rich repeat | 363..375 | CDD:275378 | 2/11 (18%) | ||
LRRCT | 371..419 | CDD:214507 | 8/47 (17%) | ||
I-set | 429..516 | CDD:400151 | 22/111 (20%) | ||
Ig strand A' | 433..438 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 441..450 | CDD:409353 | 1/8 (13%) | ||
Ig strand C | 456..460 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 463..465 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 478..481 | CDD:409353 | 1/2 (50%) | ||
Ig strand E | 482..487 | CDD:409353 | 1/4 (25%) | ||
Ig strand F | 495..503 | CDD:409353 | 5/7 (71%) | ||
Ig strand G | 506..516 | CDD:409353 | 2/9 (22%) | ||
FN3 | 531..600 | CDD:214495 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 691..716 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | mtm9069 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |