DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and tril

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_009292463.1 Gene:tril / 448885 ZFINID:ZDB-GENE-131218-1 Length:758 Species:Danio rerio


Alignment Length:303 Identity:73/303 - (24%)
Similarity:119/303 - (39%) Gaps:76/303 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 CLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLI 160
            |:..:.||:...:.     |.|.||.|:::.:..|  ..|.||..::|...|||.|:|:||.:|.
Zfish   145 CIPKSFTHLNSLVK-----LRLDGNSIEVLKESVF--EGLPNLMFLHLESNHLRRIDRNAFLRLS 202

  Fly   161 NLVELDLSQNLLSAIPSLALY-HVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIA 224
            .|..|:||.|..:.:..:.:: .:..|:.|.::||.|..|.:..|..:.:|.||.||..::|.:.
Zfish   203 KLQFLNLSDNKQTELQDVFMFSDLKSLKTLLIAGNQIRHVGNHVFQSLKKLSKLSLSHNKISKLG 267

  Fly   225 VRAFAGLE-----------------------------------------------SSLEWLKLDG 242
            ..||.||.                                               |.|:.|||..
Zfish   268 NEAFKGLGRVREFMIDRNELTEIPAGLLDPLERIEHLDFSDNHISLVDQGAFGHLSHLKILKLKN 332

  Fly   243 NRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQQNIPSGIPPT---CESPPRLSGR 304
            |||..:......|...|..:||..|.|.|.|.:..|::||...:....:...   |..||.|:|:
Zfish   333 NRLMNLSGSIFASNGGLFHVELNGNNWTCDCRMEKLKSWMTHAHSQGKLLTVFVRCLHPPVLAGK 397

  Fly   305 AWDKLDVDDFACVPQIVATDTTAHGVEGRNITMSCYVEGVPQP 347
            ..|.:.                  .::.:|::..|..|.:.||
Zfish   398 YLDYVS------------------NLQLKNMSGFCESEPLSQP 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 52/204 (25%)
leucine-rich repeat 112..137 CDD:275380 7/24 (29%)
LRR_8 137..196 CDD:290566 20/59 (34%)
leucine-rich repeat 138..161 CDD:275380 10/22 (45%)
leucine-rich repeat 162..185 CDD:275380 5/23 (22%)
LRR_8 184..245 CDD:290566 23/107 (21%)
leucine-rich repeat 186..209 CDD:275380 7/22 (32%)
leucine-rich repeat 210..234 CDD:275380 10/70 (14%)
leucine-rich repeat 235..258 CDD:275380 8/22 (36%)
LRRCT 267..316 CDD:214507 13/51 (25%)
IG_like 328..428 CDD:214653 5/20 (25%)
Ig 335..425 CDD:143165 4/13 (31%)
trilXP_009292463.1 LRRNT 25..56 CDD:214470
leucine-rich repeat 60..83 CDD:275380
LRR_8 84..142 CDD:290566
LRR_4 84..123 CDD:289563
leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380
leucine-rich repeat 132..155 CDD:275380 3/9 (33%)
LRR_8 155..213 CDD:290566 22/64 (34%)
LRR_RI 156..>358 CDD:238064 52/208 (25%)
leucine-rich repeat 156..179 CDD:275380 7/29 (24%)
leucine-rich repeat 180..203 CDD:275380 10/22 (45%)
leucine-rich repeat 204..228 CDD:275380 5/23 (22%)
leucine-rich repeat 229..252 CDD:275380 7/22 (32%)
leucine-rich repeat 253..276 CDD:275380 10/22 (45%)
LRR_8 259..311 CDD:290566 6/51 (12%)
leucine-rich repeat 277..298 CDD:275380 0/20 (0%)
LRR_8 300..358 CDD:290566 12/57 (21%)
leucine-rich repeat 301..324 CDD:275380 0/22 (0%)
leucine-rich repeat 325..348 CDD:275380 8/22 (36%)
FN3 546..614 CDD:214495
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574215
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.