Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009292463.1 | Gene: | tril / 448885 | ZFINID: | ZDB-GENE-131218-1 | Length: | 758 | Species: | Danio rerio |
Alignment Length: | 303 | Identity: | 73/303 - (24%) |
---|---|---|---|
Similarity: | 119/303 - (39%) | Gaps: | 76/303 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 96 CLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLI 160
Fly 161 NLVELDLSQNLLSAIPSLALY-HVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIA 224
Fly 225 VRAFAGLE-----------------------------------------------SSLEWLKLDG 242
Fly 243 NRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQQNIPSGIPPT---CESPPRLSGR 304
Fly 305 AWDKLDVDDFACVPQIVATDTTAHGVEGRNITMSCYVEGVPQP 347 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 52/204 (25%) |
leucine-rich repeat | 112..137 | CDD:275380 | 7/24 (29%) | ||
LRR_8 | 137..196 | CDD:290566 | 20/59 (34%) | ||
leucine-rich repeat | 138..161 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 162..185 | CDD:275380 | 5/23 (22%) | ||
LRR_8 | 184..245 | CDD:290566 | 23/107 (21%) | ||
leucine-rich repeat | 186..209 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 210..234 | CDD:275380 | 10/70 (14%) | ||
leucine-rich repeat | 235..258 | CDD:275380 | 8/22 (36%) | ||
LRRCT | 267..316 | CDD:214507 | 13/51 (25%) | ||
IG_like | 328..428 | CDD:214653 | 5/20 (25%) | ||
Ig | 335..425 | CDD:143165 | 4/13 (31%) | ||
tril | XP_009292463.1 | LRRNT | 25..56 | CDD:214470 | |
leucine-rich repeat | 60..83 | CDD:275380 | |||
LRR_8 | 84..142 | CDD:290566 | |||
LRR_4 | 84..123 | CDD:289563 | |||
leucine-rich repeat | 84..107 | CDD:275380 | |||
leucine-rich repeat | 108..131 | CDD:275380 | |||
leucine-rich repeat | 132..155 | CDD:275380 | 3/9 (33%) | ||
LRR_8 | 155..213 | CDD:290566 | 22/64 (34%) | ||
LRR_RI | 156..>358 | CDD:238064 | 52/208 (25%) | ||
leucine-rich repeat | 156..179 | CDD:275380 | 7/29 (24%) | ||
leucine-rich repeat | 180..203 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 204..228 | CDD:275380 | 5/23 (22%) | ||
leucine-rich repeat | 229..252 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 253..276 | CDD:275380 | 10/22 (45%) | ||
LRR_8 | 259..311 | CDD:290566 | 6/51 (12%) | ||
leucine-rich repeat | 277..298 | CDD:275380 | 0/20 (0%) | ||
LRR_8 | 300..358 | CDD:290566 | 12/57 (21%) | ||
leucine-rich repeat | 301..324 | CDD:275380 | 0/22 (0%) | ||
leucine-rich repeat | 325..348 | CDD:275380 | 8/22 (36%) | ||
FN3 | 546..614 | CDD:214495 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170574215 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |