| Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001005214.2 | Gene: | LRRC52 / 440699 | HGNCID: | 32156 | Length: | 313 | Species: | Homo sapiens |
| Alignment Length: | 254 | Identity: | 65/254 - (25%) |
|---|---|---|---|
| Similarity: | 106/254 - (41%) | Gaps: | 47/254 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 77 AECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQLLNL--Q 139
Fly 140 KVYLARC---HLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPD 201
Fly 202 DAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELAR 266
Fly 267 NTWNCSCSLRPLRAWMLQQNI-PS-GIPPTCESPPRLSGRAWDKLDVDD---FACVPQI 320 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 41/161 (25%) |
| leucine-rich repeat | 112..137 | CDD:275380 | 7/24 (29%) | ||
| LRR_8 | 137..196 | CDD:290566 | 19/63 (30%) | ||
| leucine-rich repeat | 138..161 | CDD:275380 | 7/27 (26%) | ||
| leucine-rich repeat | 162..185 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 184..245 | CDD:290566 | 12/60 (20%) | ||
| leucine-rich repeat | 186..209 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 210..234 | CDD:275380 | 2/23 (9%) | ||
| leucine-rich repeat | 235..258 | CDD:275380 | 6/22 (27%) | ||
| LRRCT | 267..316 | CDD:214507 | 14/53 (26%) | ||
| IG_like | 328..428 | CDD:214653 | |||
| Ig | 335..425 | CDD:143165 | |||
| LRRC52 | NP_001005214.2 | PRK15387 | <2..>93 | CDD:185285 | 23/79 (29%) |
| LRRNT | 26..55 | CDD:214470 | 9/32 (28%) | ||
| leucine-rich repeat | 35..54 | CDD:275380 | 5/18 (28%) | ||
| LRR 1 | 54..75 | 8/26 (31%) | |||
| leucine-rich repeat | 55..78 | CDD:275380 | 9/28 (32%) | ||
| LRR 2 | 78..99 | 6/21 (29%) | |||
| LRR_8 | 79..136 | CDD:338972 | 17/57 (30%) | ||
| leucine-rich repeat | 79..102 | CDD:275380 | 6/23 (26%) | ||
| LRR 3 | 102..123 | 8/20 (40%) | |||
| leucine-rich repeat | 103..126 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 126..185 | CDD:338972 | 17/82 (21%) | ||
| LRR 4 | 126..148 | 7/31 (23%) | |||
| leucine-rich repeat | 127..151 | CDD:275380 | 7/47 (15%) | ||
| LRR 5 | 151..172 | 6/20 (30%) | |||
| leucine-rich repeat | 152..175 | CDD:275380 | 6/22 (27%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165141314 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||