Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013675.1 | Gene: | LRRC26 / 389816 | HGNCID: | 31409 | Length: | 334 | Species: | Homo sapiens |
Alignment Length: | 265 | Identity: | 86/265 - (32%) |
---|---|---|---|
Similarity: | 115/265 - (43%) | Gaps: | 48/265 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 RPRLPLHLHLLL------W--LLCCCSQLGQLRA-ECPAVCECKWKSGKESVLCLNANLTHIPQP 107
Fly 108 LDAGTQLLDLSGNEIQLIPDDSFATA---QLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQ 169
Fly 170 NLLSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESS 234
Fly 235 LEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQQNIPSGIPPT--CES 297
Fly 298 PPRLS 302 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 45/159 (28%) |
leucine-rich repeat | 112..137 | CDD:275380 | 8/27 (30%) | ||
LRR_8 | 137..196 | CDD:290566 | 21/58 (36%) | ||
leucine-rich repeat | 138..161 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 162..185 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 184..245 | CDD:290566 | 15/60 (25%) | ||
leucine-rich repeat | 186..209 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 210..234 | CDD:275380 | 4/23 (17%) | ||
leucine-rich repeat | 235..258 | CDD:275380 | 4/22 (18%) | ||
LRRCT | 267..316 | CDD:214507 | 16/38 (42%) | ||
IG_like | 328..428 | CDD:214653 | |||
Ig | 335..425 | CDD:143165 | |||
LRRC26 | NP_001013675.1 | LRR 1 | 72..93 | 5/20 (25%) | |
LRR 2 | 96..117 | 8/25 (32%) | |||
LRR_RI | 97..>253 | CDD:238064 | 54/172 (31%) | ||
LRR_8 | 97..155 | CDD:290566 | 23/62 (37%) | ||
leucine-rich repeat | 97..120 | CDD:275380 | 9/27 (33%) | ||
LRR 3 | 120..141 | 8/20 (40%) | |||
leucine-rich repeat | 121..144 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 143..202 | CDD:290566 | 21/83 (25%) | ||
LRR 4 | 144..167 | 9/22 (41%) | |||
leucine-rich repeat | 145..168 | CDD:275380 | 9/22 (41%) | ||
LRR 5 | 168..190 | 7/46 (15%) | |||
leucine-rich repeat | 169..192 | CDD:275380 | 8/47 (17%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 298..334 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165141308 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |