| Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_647931.1 | Gene: | CG7509 / 38579 | FlyBaseID: | FBgn0035575 | Length: | 615 | Species: | Drosophila melanogaster |
| Alignment Length: | 224 | Identity: | 66/224 - (29%) |
|---|---|---|---|
| Similarity: | 95/224 - (42%) | Gaps: | 27/224 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 115 LDLSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLA 179
Fly 180 LYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLE------------ 232
Fly 233 -----------SSLEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQ-- 284
Fly 285 QNIPSGIPPTCESPPRLSGRAWDKLDVDD 313 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 51/174 (29%) |
| leucine-rich repeat | 112..137 | CDD:275380 | 10/21 (48%) | ||
| LRR_8 | 137..196 | CDD:290566 | 19/58 (33%) | ||
| leucine-rich repeat | 138..161 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 162..185 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 184..245 | CDD:290566 | 22/83 (27%) | ||
| leucine-rich repeat | 186..209 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 210..234 | CDD:275380 | 7/46 (15%) | ||
| leucine-rich repeat | 235..258 | CDD:275380 | 8/22 (36%) | ||
| LRRCT | 267..316 | CDD:214507 | 15/49 (31%) | ||
| IG_like | 328..428 | CDD:214653 | |||
| Ig | 335..425 | CDD:143165 | |||
| CG7509 | NP_647931.1 | LRR_8 | 182..241 | CDD:290566 | |
| leucine-rich repeat | 187..206 | CDD:275380 | |||
| LRR_RI | <201..386 | CDD:238064 | 21/57 (37%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | |||
| leucine-rich repeat | 231..254 | CDD:275380 | |||
| LRR_8 | 253..313 | CDD:290566 | |||
| leucine-rich repeat | 255..278 | CDD:275380 | |||
| leucine-rich repeat | 279..302 | CDD:275380 | |||
| LRR_8 | 303..361 | CDD:290566 | 12/32 (38%) | ||
| leucine-rich repeat | 303..326 | CDD:275380 | |||
| leucine-rich repeat | 327..350 | CDD:275380 | 10/21 (48%) | ||
| LRR_8 | 349..407 | CDD:290566 | 18/57 (32%) | ||
| LRR_4 | 350..390 | CDD:289563 | 13/39 (33%) | ||
| leucine-rich repeat | 351..374 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 375..398 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 398..>443 | CDD:290566 | 14/44 (32%) | ||
| leucine-rich repeat | 399..422 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 423..443 | CDD:275380 | 5/19 (26%) | ||
| leucine-rich repeat | 471..494 | CDD:275380 | 8/22 (36%) | ||
| LRRCT | 503..554 | CDD:214507 | 15/49 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45438693 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||