DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and ISLR

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_005536.1 Gene:ISLR / 3671 HGNCID:6133 Length:428 Species:Homo sapiens


Alignment Length:389 Identity:110/389 - (28%)
Similarity:169/389 - (43%) Gaps:65/389 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LHLLLWLLCCCSQLGQLRAECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQ 123
            ||||.|.|.    ||..:| ||..|:|..|.|.:...|...:|..:|....|....|.||.|.:.
Human     4 LHLLWWALL----LGLAQA-CPEPCDCGEKYGFQIADCAYRDLESVPPGFPANVTTLSLSANRLP 63

  Fly   124 LIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELRE 188
            .:|:.:|....|  ||.::||...:|.:...|...|.:|..||||.||:|......|:::|.|:.
Human    64 GLPEGAFREVPL--LQSLWLAHNEIRTVAAGALASLSHLKSLDLSHNLISDFAWSDLHNLSALQL 126

  Fly   189 LRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTI 253
            |::..|.:..:|.|||                     |:...|.|    |:|:.|||..:..||.
Human   127 LKMDSNELTFIPRDAF---------------------RSLRALRS----LQLNHNRLHTLAEGTF 166

  Fly   254 TSLASLHGLELARNTWNCSCSLRPLRAWMLQQ--NIPSGIPPTCESPPRLSGRAWDKLDVDDFAC 316
            |.|.:|..|::..|.::|:|.:..|:.|.|..  :||......|.||..|.|....:|  ....|
Human   167 TPLTALSHLQINENPFDCTCGIVWLKTWALTTAVSIPEQDNIACTSPHVLKGTPLSRL--PPLPC 229

  Fly   317 -VPQI-VATDTTAHGVE---GRNITMSCYVEGVPQPAVKWLLKNRL----IANLSAGGDGD---- 368
             .|.: ::...:..|.|   |..:.:.|.|:|.|.|.:.|.::...    |.:.:.|.||.    
Human   230 SAPSVQLSYQPSQDGAELRPGFVLALHCDVDGQPAPQLHWHIQIPSGIVEITSPNVGTDGRALPG 294

  Fly   369 ---SDSEPRTAAATQGRKTYVVNMLRNASNLTILTADMQDAGIYTCAAENKAGKVEASVTLAVS 429
               :.|:||..|...|             :|.|......:.|.|:|.|.|:.|..|:||.:|::
Human   295 TPVASSQPRFQAFANG-------------SLLIPDFGKLEEGTYSCLATNELGSAESSVDVALA 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 46/156 (29%)
leucine-rich repeat 112..137 CDD:275380 7/24 (29%)
LRR_8 137..196 CDD:290566 20/58 (34%)
leucine-rich repeat 138..161 CDD:275380 7/22 (32%)
leucine-rich repeat 162..185 CDD:275380 9/22 (41%)
LRR_8 184..245 CDD:290566 14/60 (23%)
leucine-rich repeat 186..209 CDD:275380 7/22 (32%)
leucine-rich repeat 210..234 CDD:275380 2/23 (9%)
leucine-rich repeat 235..258 CDD:275380 9/22 (41%)
LRRCT 267..316 CDD:214507 14/50 (28%)
IG_like 328..428 CDD:214653 29/113 (26%)
Ig 335..425 CDD:143165 25/100 (25%)
ISLRNP_005536.1 leucine-rich repeat 32..51 CDD:275380 3/18 (17%)
LRR_8 51..110 CDD:316378 20/60 (33%)
LRR 1 51..72 6/20 (30%)
leucine-rich repeat 52..75 CDD:275380 6/22 (27%)
LRR 2 75..96 7/22 (32%)
leucine-rich repeat 76..99 CDD:275380 7/22 (32%)
LRR_8 98..158 CDD:316378 23/84 (27%)
LRR 3 99..122 9/22 (41%)
leucine-rich repeat 100..123 CDD:275380 9/22 (41%)
LRR 4 123..144 7/41 (17%)
leucine-rich repeat 124..147 CDD:275380 8/43 (19%)
LRR 5 147..168 9/24 (38%)
leucine-rich repeat 148..171 CDD:275380 11/26 (42%)
PCC 153..>227 CDD:188093 24/75 (32%)
I-set 239..340 CDD:333254 27/113 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.