DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and Lgi4

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_955793.1 Gene:Lgi4 / 361549 RGDID:735035 Length:537 Species:Rattus norvegicus


Alignment Length:525 Identity:110/525 - (20%)
Similarity:172/525 - (32%) Gaps:170/525 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RAECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQK 140
            :.:||..|.|    .|||.||..:     |:                  :| :||:|. ||:|. 
  Rat    24 KGKCPPRCSC----SKESTLCEGS-----PE------------------LP-ESFSTT-LLSLS- 58

  Fly   141 VYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAFG 205
              |.|..:..::..:|.|:                |||.|        |..:.|....:..|||.
  Rat    59 --LVRMGVSRLKAGSFLKM----------------PSLHL--------LLFTSNTFSVIEGDAFI 97

  Fly   206 HVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWN 270
            .:..|..|.:.|.::..|:..|..||. ||..|.|..|.|..:.......|.:|..::|..|.:.
  Rat    98 GLSYLQYLFIEDNKIGSISKNALRGLR-SLTHLSLANNHLEALPRFLFQGLETLTHVDLRGNPFQ 161

  Fly   271 CSCSLRPLRAWMLQQNIPSGIPPTCESPPRLSGRAWDKLDVDDFACVPQIVATDTTAHGVEGRNI 335
            |.|.:..|..||...|...| ...|..|..|:....:.||...|.|    .||:.:         
  Rat   162 CDCRVLWLLQWMPMVNASVG-TGACAGPSALAQIQLNHLDPKKFKC----KATELS--------- 212

  Fly   336 TMSCYVEGVPQPAVKWLLKNRLIANLSAGGDGDSDSEPRTAAATQGRKTYVVNMLRNASNLTILT 400
                :::.|.:.|:.       :.:.|..|      ||....|..           .|....|| 
  Rat   213 ----WLQTVGESALS-------VESFSYQG------EPHMVLAQP-----------FAGRCLIL- 248

  Fly   401 ADMQDAGIYTCAAENKAGKVEASVTLAVSRRPPEAPWGVRIILLGAVAALLLVGGSSFAAICLCS 465
                   ::..:.:....:.|.|....||.:|  ...|.|:.:|.|    .|.|||         
  Rat   249 -------VWDYSLQRFRSEEELSAPSVVSCKP--LVLGPRLFILAA----RLWGGS--------- 291

  Fly   466 LQRRRKLRLWNSVPPVRRSESYEKIEMTARTRPDLGGGASCGGGSATGAGLFHDAE------EQG 524
                   :||:...|..|....:.:......||                   :|||      :..
  Rat   292 -------QLWSRSSPDLRLTPVQVLAPQRLLRP-------------------NDAELLWLDGQPC 330

  Fly   525 YLRAAHTPLNDNDAGQAAAIVNPSAGSAQRRNGDYLHVSTHCDDEEEDQQLHHHP-------QQQ 582
            ::.|     :.:.||....:.....|...|::   || :.|.|.:.|..:|...|       .|:
  Rat   331 FVVA-----DASKAGSTTLLCRDGPGFYPRQS---LH-AWHRDTDAEALELDGRPHLLLASASQR 386

  Fly   583 PASQH 587
            |...|
  Rat   387 PVLFH 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 36/156 (23%)
leucine-rich repeat 112..137 CDD:275380 5/24 (21%)
LRR_8 137..196 CDD:290566 11/58 (19%)
leucine-rich repeat 138..161 CDD:275380 5/22 (23%)
leucine-rich repeat 162..185 CDD:275380 4/22 (18%)
LRR_8 184..245 CDD:290566 17/60 (28%)
leucine-rich repeat 186..209 CDD:275380 5/22 (23%)
leucine-rich repeat 210..234 CDD:275380 7/23 (30%)
leucine-rich repeat 235..258 CDD:275380 6/22 (27%)
LRRCT 267..316 CDD:214507 14/48 (29%)
IG_like 328..428 CDD:214653 12/99 (12%)
Ig 335..425 CDD:143165 12/89 (13%)
Lgi4NP_955793.1 leucine-rich repeat 54..77 CDD:275378 7/41 (17%)
LRR_8 76..136 CDD:290566 21/68 (31%)
leucine-rich repeat 78..101 CDD:275378 7/30 (23%)
LRR_4 102..140 CDD:289563 13/38 (34%)
leucine-rich repeat 102..125 CDD:275378 7/23 (30%)
leucine-rich repeat 126..149 CDD:275378 6/22 (27%)
leucine-rich repeat 150..162 CDD:275378 3/11 (27%)
LRRCT 158..207 CDD:214507 15/53 (28%)
EPTP <220..251 CDD:281697 9/62 (15%)
EPTP 351..392 CDD:281697 12/45 (27%)
EPTP 396..438 CDD:281697
EPTP 441..482 CDD:281697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335005
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.