DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and CG18095

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster


Alignment Length:338 Identity:80/338 - (23%)
Similarity:125/338 - (36%) Gaps:114/338 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LCLNAN-LTHIPQPLDAG---TQLLDLSGNEIQLIPDDSFAT--------------AQLLNLQKV 141
            |.||.| |.||......|   ...|.|..|.|:.|..|||.:              :.|..|.:.
  Fly   164 LYLNGNQLAHIDGSFFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQR 228

  Fly   142 YLAR-CHLRL-------IERHAFRKLINLVELDLSQN--------LLSAIPSLALYHVSE----- 185
            .||| .||.|       :|...|.|...|.:||||.|        .||.:.||...::|.     
  Fly   229 GLARLVHLNLSSNLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDK 293

  Fly   186 -----------LRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLK 239
                       |.:|.:|.|.:..:||:.|....||.::.|::.::..|:.:.... ::.|.::|
  Fly   294 IYDESLDSLIALLQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISSQMMFN-QNHLRYIK 357

  Fly   240 LDGNRLSE------------------------VRSGTITSLASLHGLELARNTWNCSCSLRPLRA 280
            |.||.:|:                        ::|..::||.....:.||.|.|:|:        
  Fly   358 LSGNAISDAAFLDRLSPSVNRFTLYVDLSSNRLKSLNLSSLLHFRYINLADNNWSCN-------- 414

  Fly   281 WM---LQQNIPSGIPPTCESPPRLSGRAW--------DKLDVDDFACVPQIVATDTTAHGVEGRN 334
            |:   |.|.:|:.:.         ..|.|        :..:|:...|:          .|...|:
  Fly   415 WLVANLVQKLPNSVN---------FARPWTVINNLSENTTNVEGIDCI----------EGGTNRS 460

  Fly   335 ITMSCYVEGVPQP 347
            |.: ..|.|||||
  Fly   461 IIL-LDVSGVPQP 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 53/229 (23%)
leucine-rich repeat 112..137 CDD:275380 9/38 (24%)
LRR_8 137..196 CDD:290566 25/90 (28%)
leucine-rich repeat 138..161 CDD:275380 10/30 (33%)
leucine-rich repeat 162..185 CDD:275380 10/30 (33%)
LRR_8 184..245 CDD:290566 17/76 (22%)
leucine-rich repeat 186..209 CDD:275380 7/22 (32%)
leucine-rich repeat 210..234 CDD:275380 3/23 (13%)
leucine-rich repeat 235..258 CDD:275380 9/46 (20%)
LRRCT 267..316 CDD:214507 10/59 (17%)
IG_like 328..428 CDD:214653 9/20 (45%)
Ig 335..425 CDD:143165 7/13 (54%)
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380
LRR_8 64..123 CDD:290566
leucine-rich repeat 65..88 CDD:275380
leucine-rich repeat 89..112 CDD:275380
leucine-rich repeat 113..136 CDD:275380
LRR_RI 115..384 CDD:238064 55/220 (25%)
LRR_8 135..195 CDD:290566 11/30 (37%)
leucine-rich repeat 137..160 CDD:275380
leucine-rich repeat 161..184 CDD:275380 8/19 (42%)
LRR_8 184..243 CDD:290566 16/58 (28%)
leucine-rich repeat 185..208 CDD:275380 8/22 (36%)
leucine-rich repeat 209..232 CDD:275380 3/22 (14%)
LRR_8 232..289 CDD:290566 18/56 (32%)
leucine-rich repeat 233..256 CDD:275380 6/22 (27%)
leucine-rich repeat 257..280 CDD:275380 8/22 (36%)
LRR_8 280..339 CDD:290566 13/58 (22%)
leucine-rich repeat 281..304 CDD:275380 2/22 (9%)
leucine-rich repeat 305..328 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438692
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.