DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and CG1504

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_001259742.1 Gene:CG1504 / 33028 FlyBaseID:FBgn0031100 Length:425 Species:Drosophila melanogaster


Alignment Length:421 Identity:97/421 - (23%)
Similarity:149/421 - (35%) Gaps:142/421 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LPLHLHLLLWLLCCCSQLGQLRAECPAVCECKWKSGKESVLCLNANLTHIP-QPLDAGTQLLDLS 118
            :.|.:.:.||    .||..:....|||.|.|   ..:..|||....|..|| :.|.|..:.|.|:
  Fly    10 IALSVVVCLW----NSQQTETSKSCPAECIC---LSQTQVLCNTGGLEQIPLRQLPATVENLALT 67

  Fly   119 GNEIQLIPDDSFATAQLL----------------------NLQKVYLARCHLRLIERHAFRKLIN 161
            .|...:|..||||..:.|                      .|:::.:....|:::.:.||..|.|
  Fly    68 KNNFPIIKPDSFAGLRALKKLSLDGNNITRIKQFAFRGLPRLKELSIQYTPLQMVAQFAFAGLQN 132

  Fly   162 LVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAF------GH--VPQ--------- 209
            |..:.||.|.:..|...|....|.::.:.|:.||::|:...||      ||  :|.         
  Fly   133 LSTILLSHNQIQRIEGNAFAGTSNIKLILLTNNPLIRIDSSAFSSLTNVGHLILPSGIRSIEQDA 197

  Fly   210 --------LVKLELSDCR----------------------LSHIAVRAFAGLESSLEWLKLDGNR 244
                    |:||...|.:                      |..|...||.|| :.:|.|::..|:
  Fly   198 FFGMDTVGLLKLAYMDLKEVAPFTFRGLSNVLLLTLQESDLGVICADAFTGL-TQVETLQILNNK 261

  Fly   245 LSEVRSGTITSLASL--------HGLE----------------LARNTWNCSCSLR-----PLRA 280
            :..:.....||.|::        |.||                |..|.:.|.|.:.     ||..
  Fly   262 IDSIEELNFTSTAAIKHLKFFGNHVLETPDPNSIIVDGVEHLQLVSNHFPCGCHIHTLLDGPLAE 326

  Fly   281 W------MLQQNIPSGIPPTCESPPRLSGRAWDKLDVDDFA-CVPQIV------ATDTTAHGVEG 332
            .      .||:|.       |.||..::||...:||:|... |..|:.      :..:.|.|:..
  Fly   327 GAHNLTDFLQKNY-------CISPLEVNGRVMSELDIDSIGRCSDQLTKGNLGSSAASLALGINS 384

  Fly   333 RNI--TMSCYVEGVPQPAVKW----LLKNRL 357
            ..:  ..||         .:|    ||.|||
  Fly   385 MLLIAVASC---------AEWRHVRLLANRL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 52/249 (21%)
leucine-rich repeat 112..137 CDD:275380 9/46 (20%)
LRR_8 137..196 CDD:290566 15/58 (26%)
leucine-rich repeat 138..161 CDD:275380 5/22 (23%)
leucine-rich repeat 162..185 CDD:275380 6/22 (27%)
LRR_8 184..245 CDD:290566 23/107 (21%)
leucine-rich repeat 186..209 CDD:275380 8/30 (27%)
leucine-rich repeat 210..234 CDD:275380 10/45 (22%)
leucine-rich repeat 235..258 CDD:275380 5/22 (23%)
LRRCT 267..316 CDD:214507 16/60 (27%)
IG_like 328..428 CDD:214653 9/36 (25%)
Ig 335..425 CDD:143165 8/29 (28%)
CG1504NP_001259742.1 leucine-rich repeat 61..84 CDD:275380 8/22 (36%)
LRR_5 73..200 CDD:404228 28/126 (22%)
leucine-rich repeat 85..108 CDD:275380 1/22 (5%)
leucine-rich repeat 109..132 CDD:275380 5/22 (23%)
leucine-rich repeat 133..156 CDD:275380 6/22 (27%)
leucine-rich repeat 157..180 CDD:275380 6/22 (27%)
leucine-rich repeat 181..203 CDD:275380 3/21 (14%)
leucine-rich repeat 204..227 CDD:275380 4/22 (18%)
leucine-rich repeat 228..251 CDD:275380 6/23 (26%)
leucine-rich repeat 252..275 CDD:275380 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.