Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001100254.1 | Gene: | Lgr5 / 299802 | RGDID: | 1307733 | Length: | 907 | Species: | Rattus norvegicus |
Alignment Length: | 257 | Identity: | 80/257 - (31%) |
---|---|---|---|
Similarity: | 115/257 - (44%) | Gaps: | 25/257 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 RPRLPLHLHLLLWLLCCCS--QLGQLRAECPAVCECKWKSGKE--SVLCLNANLTHIPQPLDAGT 112
Fly 113 QLLDLSGNEIQLIPDDSFATAQLLN----LQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLS 173
Fly 174 AIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWL 238
Fly 239 KLDGNRLSEVRSGTITSLASLHGLELARNTWN-----CSCSLRPLRAWMLQQN----IPSGI 291 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 54/160 (34%) |
leucine-rich repeat | 112..137 | CDD:275380 | 10/24 (42%) | ||
LRR_8 | 137..196 | CDD:290566 | 21/62 (34%) | ||
leucine-rich repeat | 138..161 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 162..185 | CDD:275380 | 8/22 (36%) | ||
LRR_8 | 184..245 | CDD:290566 | 22/60 (37%) | ||
leucine-rich repeat | 186..209 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 210..234 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 235..258 | CDD:275380 | 4/22 (18%) | ||
LRRCT | 267..316 | CDD:214507 | 8/34 (24%) | ||
IG_like | 328..428 | CDD:214653 | |||
Ig | 335..425 | CDD:143165 | |||
Lgr5 | NP_001100254.1 | LRRNT | 33..70 | CDD:214470 | 11/37 (30%) |
LRR 1 | 44..64 | 5/19 (26%) | |||
LRR 2 | 65..88 | 11/28 (39%) | |||
leucine-rich repeat | 68..91 | CDD:275380 | 11/28 (39%) | ||
LRR_RI | 88..372 | CDD:238064 | 51/167 (31%) | ||
LRR 3 | 89..112 | 7/22 (32%) | |||
LRR_8 | 92..150 | CDD:290566 | 21/57 (37%) | ||
leucine-rich repeat | 92..115 | CDD:275380 | 8/22 (36%) | ||
LRR 4 | 114..136 | 8/21 (38%) | |||
leucine-rich repeat | 116..139 | CDD:275380 | 8/22 (36%) | ||
LRR 5 | 137..160 | 9/22 (41%) | |||
LRR_8 | 138..198 | CDD:290566 | 22/60 (37%) | ||
leucine-rich repeat | 140..163 | CDD:275380 | 9/22 (41%) | ||
LRR 6 | 162..184 | 8/21 (38%) | |||
leucine-rich repeat | 164..187 | CDD:275380 | 9/23 (39%) | ||
LRR 7 | 186..208 | 4/21 (19%) | |||
LRR_8 | 188..246 | CDD:290566 | 14/57 (25%) | ||
leucine-rich repeat | 188..211 | CDD:275380 | 4/22 (18%) | ||
LRR 8 | 209..232 | 7/22 (32%) | |||
leucine-rich repeat | 212..235 | CDD:275380 | 6/22 (27%) | ||
LRR 9 | 233..256 | 6/21 (29%) | |||
leucine-rich repeat | 236..258 | CDD:275380 | 5/18 (28%) | ||
LRR_8 | 257..314 | CDD:290566 | |||
LRR 10 | 257..279 | ||||
leucine-rich repeat | 259..282 | CDD:275380 | |||
LRR 11 | 281..303 | ||||
leucine-rich repeat | 283..304 | CDD:275380 | |||
LRR 12 | 304..327 | ||||
leucine-rich repeat | 307..353 | CDD:275380 | |||
LRR 13 | 328..350 | ||||
LRR 14 | 351..375 | ||||
LRR_8 | 352..410 | CDD:290566 | |||
leucine-rich repeat | 354..375 | CDD:275380 | |||
leucine-rich repeat | 376..399 | CDD:275380 | |||
LRR 15 | 377..396 | ||||
LRR 16 | 397..420 | ||||
leucine-rich repeat | 400..423 | CDD:275380 | |||
LRR 17 | 422..444 | ||||
leucine-rich repeat | 445..467 | CDD:275378 | |||
LRR 18 | 564..585 | ||||
7tm_1 | 575..820 | CDD:278431 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166335009 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |