Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_062037.1 | Gene: | Chad / 29195 | RGDID: | 2336 | Length: | 358 | Species: | Rattus norvegicus |
Alignment Length: | 341 | Identity: | 86/341 - (25%) |
---|---|---|---|
Similarity: | 129/341 - (37%) | Gaps: | 108/341 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 LLLWLLCCCSQLGQLRAECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLI 125
Fly 126 PDDSFATAQLLNLQKVYLARCHLRLIERHAFR---KLI--------------------------- 160
Fly 161 ----------------------------------------------------------------- 160
Fly 161 -NLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQ-LVKLELSDCRLSHI 223
Fly 224 AVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQQNIP 288
Fly 289 SGIPPTCESPPRLSGR 304 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 55/253 (22%) |
leucine-rich repeat | 112..137 | CDD:275380 | 8/24 (33%) | ||
LRR_8 | 137..196 | CDD:290566 | 25/154 (16%) | ||
leucine-rich repeat | 138..161 | CDD:275380 | 9/118 (8%) | ||
leucine-rich repeat | 162..185 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 184..245 | CDD:290566 | 21/61 (34%) | ||
leucine-rich repeat | 186..209 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 210..234 | CDD:275380 | 8/23 (35%) | ||
leucine-rich repeat | 235..258 | CDD:275380 | 6/22 (27%) | ||
LRRCT | 267..316 | CDD:214507 | 15/38 (39%) | ||
IG_like | 328..428 | CDD:214653 | |||
Ig | 335..425 | CDD:143165 | |||
Chad | NP_062037.1 | LRRNT | 22..48 | CDD:279764 | 9/28 (32%) |
LRR 1 | 51..72 | 7/20 (35%) | |||
leucine-rich repeat | 52..75 | CDD:275380 | 8/24 (33%) | ||
LRR_8 | 74..134 | CDD:290566 | 10/61 (16%) | ||
LRR 2 | 75..96 | 7/20 (35%) | |||
leucine-rich repeat | 76..99 | CDD:275380 | 7/22 (32%) | ||
LRR_RI | <89..281 | CDD:238064 | 38/192 (20%) | ||
LRR 3 | 99..120 | 2/20 (10%) | |||
leucine-rich repeat | 100..123 | CDD:275380 | 2/22 (9%) | ||
LRR 4 | 123..144 | 0/20 (0%) | |||
leucine-rich repeat | 124..147 | CDD:275380 | 0/22 (0%) | ||
LRR_8 | 147..206 | CDD:290566 | 4/58 (7%) | ||
LRR 5 | 147..168 | 0/20 (0%) | |||
leucine-rich repeat | 148..171 | CDD:275380 | 0/22 (0%) | ||
LRR 6 | 171..192 | 0/20 (0%) | |||
leucine-rich repeat | 172..195 | CDD:275380 | 0/22 (0%) | ||
LRR_8 | 195..255 | CDD:290566 | 23/59 (39%) | ||
LRR 7 | 195..216 | 10/20 (50%) | |||
leucine-rich repeat | 196..219 | CDD:275380 | 9/22 (41%) | ||
LRR 8 | 219..240 | 10/20 (50%) | |||
leucine-rich repeat | 220..243 | CDD:275380 | 10/22 (45%) | ||
LRR_8 | 243..300 | CDD:290566 | 17/59 (29%) | ||
LRR 9 | 244..265 | 6/20 (30%) | |||
leucine-rich repeat | 245..268 | CDD:275380 | 8/23 (35%) | ||
LRR 10 | 268..289 | 6/22 (27%) | |||
LRRCT | 299..346 | CDD:214507 | 15/38 (39%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 321..358 | 5/14 (36%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166335004 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |