DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and Rtn4rl2

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_006499655.1 Gene:Rtn4rl2 / 269295 MGIID:2669796 Length:480 Species:Mus musculus


Alignment Length:372 Identity:114/372 - (30%)
Similarity:142/372 - (38%) Gaps:71/372 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PLHLHLLLWLLCCCSQLGQLRAECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGN 120
            |....|||.||.    |..:...||.:|.|  .|...:|.|...|.:.:|..|...||.|.|..|
Mouse    72 PASACLLLTLLA----LPSVTPSCPMLCTC--YSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNN 130

  Fly   121 EIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNL------------LS 173
            .|:.:...:|..    ||..::|...:|..|....||.|..|.||||..|.            |.
Mouse   131 LIRSLRPGTFGP----NLLTLWLFSNNLSTIHPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLE 191

  Fly   174 AIPSLALYH-------------VSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAV 225
            .:.||.||.             :..|:.|.|..|.:|.:.||.|..:..|..|.|...||..:..
Mouse   192 RLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLANLSHLFLHGNRLRLLTE 256

  Fly   226 RAFAGLESSLEWLKLDGNRLSEVRSGTI-------------TSLASLHG-----------LELAR 266
            ..|.|| .||:.|.|.||||..|.....             .|||||.|           |.|..
Mouse   257 HVFRGL-GSLDRLLLHGNRLQGVHRAAFHGLSRLTILYLFNNSLASLPGEALADLPALEFLRLNA 320

  Fly   267 NTWNCSCSLRPLRAWMLQQNIPSGIPPTCESPPRLSGRAWDKLDVDDF-ACVPQIVATDTTAHGV 330
            |.|.|.|..|||.||..:..:.|. ..||.:||...||....|...|| ||.|    ...|..|.
Mouse   321 NPWACDCRARPLWAWFQRARVSSS-DVTCATPPERQGRDLRALRDSDFQACPP----PTPTRPGS 380

  Fly   331 EGRNITMSCYVEGVPQ----PAVKWLLKNRLIANLSAGGD-GDSDSE 372
            ..|..:.|.::.||.:    ||....|...|.|..|.|.. ||:.:|
Mouse   381 RARGNSSSNHLYGVAEAGAPPADPSTLYRDLPAEDSRGRQGGDAPTE 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 59/205 (29%)
leucine-rich repeat 112..137 CDD:275380 7/24 (29%)
LRR_8 137..196 CDD:290566 23/83 (28%)
leucine-rich repeat 138..161 CDD:275380 7/22 (32%)
leucine-rich repeat 162..185 CDD:275380 11/47 (23%)
LRR_8 184..245 CDD:290566 22/60 (37%)
leucine-rich repeat 186..209 CDD:275380 8/22 (36%)
leucine-rich repeat 210..234 CDD:275380 8/23 (35%)
leucine-rich repeat 235..258 CDD:275380 10/35 (29%)
LRRCT 267..316 CDD:214507 19/49 (39%)
IG_like 328..428 CDD:214653 15/50 (30%)
Ig 335..425 CDD:143165 13/43 (30%)
Rtn4rl2XP_006499655.1 leucine-rich repeat 122..143 CDD:275380 7/24 (29%)
LRR_8 143..203 CDD:338972 19/59 (32%)
leucine-rich repeat 144..167 CDD:275380 7/22 (32%)
leucine-rich repeat 168..192 CDD:275380 7/23 (30%)
leucine-rich repeat 193..216 CDD:275380 4/22 (18%)
LRR_8 216..275 CDD:338972 22/59 (37%)
leucine-rich repeat 217..240 CDD:275380 8/22 (36%)
leucine-rich repeat 241..264 CDD:275380 8/23 (35%)
LRR_8 264..322 CDD:338972 17/57 (30%)
leucine-rich repeat 265..288 CDD:275380 8/22 (36%)
leucine-rich repeat 289..312 CDD:275380 6/22 (27%)
LRRCT 321..371 CDD:214507 20/50 (40%)
PHA03247 349..>429 CDD:223021 26/83 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.