| Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_056379.1 | Gene: | LRRTM2 / 26045 | HGNCID: | 19409 | Length: | 516 | Species: | Homo sapiens |
| Alignment Length: | 336 | Identity: | 79/336 - (23%) |
|---|---|---|---|
| Similarity: | 114/336 - (33%) | Gaps: | 107/336 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 72 LGQLRAECPAVCECKWKSGKESVLCLNANLTHIPQPLDAG-----------TQL----------- 114
Fly 115 --LDLSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPS 177
Fly 178 LALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAG------------ 230
Fly 231 ----------------------------LESSLEW------------------------------ 237
Fly 238 -LKLDGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWM--LQQNIPSGIPPTCESPP 299
Fly 300 RLSGRAWDKLD 310 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 54/251 (22%) |
| leucine-rich repeat | 112..137 | CDD:275380 | 9/37 (24%) | ||
| LRR_8 | 137..196 | CDD:290566 | 19/58 (33%) | ||
| leucine-rich repeat | 138..161 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 162..185 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 184..245 | CDD:290566 | 22/131 (17%) | ||
| leucine-rich repeat | 186..209 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 210..234 | CDD:275380 | 11/63 (17%) | ||
| leucine-rich repeat | 235..258 | CDD:275380 | 9/53 (17%) | ||
| LRRCT | 267..316 | CDD:214507 | 15/46 (33%) | ||
| IG_like | 328..428 | CDD:214653 | |||
| Ig | 335..425 | CDD:143165 | |||
| LRRTM2 | NP_056379.1 | LRR 1 | 63..83 | 2/19 (11%) | |
| LRR | <65..312 | CDD:227223 | 53/248 (21%) | ||
| leucine-rich repeat | 66..86 | CDD:275380 | 2/19 (11%) | ||
| LRR 2 | 86..107 | 6/22 (27%) | |||
| leucine-rich repeat | 87..110 | CDD:275380 | 7/24 (29%) | ||
| LRR 3 | 110..131 | 3/20 (15%) | |||
| leucine-rich repeat | 111..134 | CDD:275380 | 4/22 (18%) | ||
| LRR 4 | 134..155 | 9/20 (45%) | |||
| leucine-rich repeat | 135..158 | CDD:275380 | 9/22 (41%) | ||
| LRR 5 | 158..179 | 6/20 (30%) | |||
| leucine-rich repeat | 159..182 | CDD:275380 | 6/22 (27%) | ||
| LRR 6 | 182..203 | 8/20 (40%) | |||
| leucine-rich repeat | 183..206 | CDD:275380 | 10/22 (45%) | ||
| LRR 7 | 206..227 | 0/20 (0%) | |||
| leucine-rich repeat | 207..230 | CDD:275380 | 0/22 (0%) | ||
| LRR 8 | 230..251 | 2/20 (10%) | |||
| leucine-rich repeat | 231..254 | CDD:275380 | 3/22 (14%) | ||
| LRR 9 | 254..275 | 0/20 (0%) | |||
| leucine-rich repeat | 255..278 | CDD:275380 | 0/22 (0%) | ||
| LRR 10 | 278..299 | 5/20 (25%) | |||
| leucine-rich repeat | 279..300 | CDD:275380 | 5/20 (25%) | ||
| PCC | 284..>351 | CDD:188093 | 22/70 (31%) | ||
| Involved in DLG4-binding. /evidence=ECO:0000250 | 513..516 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165141280 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||