Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_659194.1 | Gene: | Lgi2 / 246316 | MGIID: | 2180196 | Length: | 550 | Species: | Mus musculus |
Alignment Length: | 267 | Identity: | 60/267 - (22%) |
---|---|---|---|
Similarity: | 95/267 - (35%) | Gaps: | 86/267 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 LLLWLLCCCSQLGQLR--AECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQ 123
Fly 124 LIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELRE 188
Fly 189 LRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTI 253
Fly 254 TSLASLHGLELARNTWNCSCSLRPLRAWMLQQNIPSGIPPT-CESPPRLSGRAWDKLDVDDFACV 317
Fly 318 PQIVATD 324 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 29/156 (19%) |
leucine-rich repeat | 112..137 | CDD:275380 | 2/24 (8%) | ||
LRR_8 | 137..196 | CDD:290566 | 11/58 (19%) | ||
leucine-rich repeat | 138..161 | CDD:275380 | 1/22 (5%) | ||
leucine-rich repeat | 162..185 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 184..245 | CDD:290566 | 15/60 (25%) | ||
leucine-rich repeat | 186..209 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 210..234 | CDD:275380 | 5/23 (22%) | ||
leucine-rich repeat | 235..258 | CDD:275380 | 6/22 (27%) | ||
LRRCT | 267..316 | CDD:214507 | 11/49 (22%) | ||
IG_like | 328..428 | CDD:214653 | |||
Ig | 335..425 | CDD:143165 | |||
Lgi2 | NP_659194.1 | leucine-rich repeat | 63..83 | CDD:275380 | 4/44 (9%) |
LRR_8 | 94..142 | CDD:290566 | 17/72 (24%) | ||
LRR_4 | 107..143 | CDD:289563 | 10/35 (29%) | ||
leucine-rich repeat | 108..131 | CDD:275378 | 6/22 (27%) | ||
TPKR_C2 | 140..>174 | CDD:301599 | 10/35 (29%) | ||
EPTP | 224..265 | CDD:281697 | |||
EPTP | 271..311 | CDD:281697 | |||
EPTP | 316..362 | CDD:281697 | |||
EPTP | 365..407 | CDD:281697 | |||
EPTP | 412..454 | CDD:281697 | |||
EPTP | 457..498 | CDD:281697 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167831277 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |