DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and Lrrc52

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_001013400.1 Gene:Lrrc52 / 240899 MGIID:1924118 Length:314 Species:Mus musculus


Alignment Length:318 Identity:77/318 - (24%)
Similarity:120/318 - (37%) Gaps:65/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 AECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQKV 141
            ::||..|.|:    .:.|.|::.:||..|..:...|:.|.|:.|:|..:|     ..||..|..:
Mouse    24 SKCPNKCVCQ----DQEVACIDLHLTEYPADIPLNTRRLYLNNNKITSLP-----ALQLGFLSDL 79

  Fly   142 YLARC---HLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDA 203
            ....|   .:|.:..:.|..:..|:.||||.|.|::|...:...::.|..|.:|.||        
Mouse    80 VYLDCQNNRIREVMDYTFIGIFRLIYLDLSSNNLTSISPFSFSVLTNLVRLNISHNP-------- 136

  Fly   204 FGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELARNT 268
              |:..|.|.             .||. .:||.:|.|....|..:.......|..|..|.|:.|.
Mouse   137 --HLLYLDKY-------------VFAN-TTSLRYLDLRNTGLHIIDHNGFHHLVVLQTLYLSGNP 185

  Fly   269 WNCSCSLRPLRAWMLQQNI--PSGIPPTCESPPRLSGRAWDKLDVDD---FACVPQIVATD---- 324
            |.|:||.......:|..::  |.....||..|..|.|  |....|.:   :.|:..:...|    
Mouse   186 WICNCSFLDFTIHLLVSHMDHPDAQNATCTEPAELKG--WPITKVGNPLQYMCITHLDQQDYIFL 248

  Fly   325 ------TTAHGVEGRNITMSCYVEGVPQPAVKWLLKNRLIANLSAGGDGDSDSEPRTA 376
                  ..|.|.....:|..|.|          |.:|.|  ..|:|.|.:.::..|.|
Mouse   249 LLIGFCIFAAGTVAAWLTGVCAV----------LYQNAL--RTSSGDDTEDETGSRFA 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 39/159 (25%)
leucine-rich repeat 112..137 CDD:275380 8/24 (33%)
LRR_8 137..196 CDD:290566 16/61 (26%)
leucine-rich repeat 138..161 CDD:275380 4/25 (16%)
leucine-rich repeat 162..185 CDD:275380 8/22 (36%)
LRR_8 184..245 CDD:290566 14/60 (23%)
leucine-rich repeat 186..209 CDD:275380 6/22 (27%)
leucine-rich repeat 210..234 CDD:275380 4/23 (17%)
leucine-rich repeat 235..258 CDD:275380 5/22 (23%)
LRRCT 267..316 CDD:214507 14/53 (26%)
IG_like 328..428 CDD:214653 12/49 (24%)
Ig 335..425 CDD:143165 11/42 (26%)
Lrrc52NP_001013400.1 leucine-rich repeat 35..54 CDD:275380 5/18 (28%)
LRR 1 54..73 6/23 (26%)
leucine-rich repeat 56..78 CDD:275380 8/26 (31%)
LRR 2 78..99 3/20 (15%)
LRR_8 79..136 CDD:316378 14/56 (25%)
leucine-rich repeat 79..102 CDD:275380 3/22 (14%)
LRR 3 102..123 8/20 (40%)
leucine-rich repeat 103..126 CDD:275380 8/22 (36%)
LRR_8 125..185 CDD:316378 19/83 (23%)
LRR 4 126..148 9/44 (20%)
leucine-rich repeat 127..151 CDD:275380 10/47 (21%)
LRR 5 151..172 5/20 (25%)
leucine-rich repeat 152..175 CDD:275380 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831255
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.