Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001333072.1 | Gene: | FLRT2 / 23768 | HGNCID: | 3761 | Length: | 660 | Species: | Homo sapiens |
Alignment Length: | 384 | Identity: | 96/384 - (25%) |
---|---|---|---|
Similarity: | 151/384 - (39%) | Gaps: | 127/384 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 PLH--LHLLLWLLCCC---SQLGQLRAECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLL 115
Fly 116 DLSGNEI-----------------------QLIPDDSF------------------------ATA 133
Fly 134 QLLNLQKVYLARCHLRL--IERHAFRKLINLVELDLSQNLLSAIP-SLALYHVSELRELRLSGNP 195
Fly 196 ILRVPDDAF------------------------------------------GHVP------QLVK 212
Fly 213 LELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRP 277
Fly 278 LRAWMLQQNIPSGIPP---TCESPPRLSGRAWDKLDVDDFAC------VPQIVATDTTA 327 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 59/254 (23%) |
leucine-rich repeat | 112..137 | CDD:275380 | 12/71 (17%) | ||
LRR_8 | 137..196 | CDD:290566 | 21/61 (34%) | ||
leucine-rich repeat | 138..161 | CDD:275380 | 6/24 (25%) | ||
leucine-rich repeat | 162..185 | CDD:275380 | 9/23 (39%) | ||
LRR_8 | 184..245 | CDD:290566 | 24/108 (22%) | ||
leucine-rich repeat | 186..209 | CDD:275380 | 11/70 (16%) | ||
leucine-rich repeat | 210..234 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 235..258 | CDD:275380 | 7/22 (32%) | ||
LRRCT | 267..316 | CDD:214507 | 14/51 (27%) | ||
IG_like | 328..428 | CDD:214653 | 96/384 (25%) | ||
Ig | 335..425 | CDD:143165 | |||
FLRT2 | NP_001333072.1 | LRRNT | 35..66 | CDD:214470 | 12/35 (34%) |
NEL | <54..>265 | CDD:330839 | 48/217 (22%) | ||
LRR 1 | 64..85 | 5/20 (25%) | |||
leucine-rich repeat | 65..86 | CDD:275378 | 4/20 (20%) | ||
LRR 2 | 89..109 | 4/22 (18%) | |||
leucine-rich repeat | 90..110 | CDD:275380 | 4/22 (18%) | ||
LRR 3 | 110..131 | 1/20 (5%) | |||
leucine-rich repeat | 111..134 | CDD:275380 | 4/22 (18%) | ||
LRR 4 | 134..155 | 3/20 (15%) | |||
leucine-rich repeat | 135..160 | CDD:275380 | 6/24 (25%) | ||
LRR 5 | 160..181 | 9/24 (38%) | |||
leucine-rich repeat | 161..181 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 182..205 | CDD:275380 | 9/22 (41%) | ||
LRR 6 | 182..202 | 9/19 (47%) | |||
LRR 7 | 205..225 | 0/19 (0%) | |||
leucine-rich repeat | 206..231 | CDD:275380 | 0/24 (0%) | ||
LRR 8 | 231..252 | 2/20 (10%) | |||
leucine-rich repeat | 232..253 | CDD:275380 | 2/20 (10%) | ||
LRR_8 | 252..311 | CDD:316378 | 18/59 (31%) | ||
LRR 9 | 253..274 | 8/20 (40%) | |||
leucine-rich repeat | 254..277 | CDD:275380 | 9/23 (39%) | ||
LRR 10 | 277..298 | 6/20 (30%) | |||
leucine-rich repeat | 278..301 | CDD:275380 | 7/22 (32%) | ||
PCC | 282..>359 | CDD:188093 | 20/78 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 373..413 | 2/5 (40%) | |||
fn3 | 426..494 | CDD:306538 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |