DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and SLITRK3

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_001305739.1 Gene:SLITRK3 / 22865 HGNCID:23501 Length:977 Species:Homo sapiens


Alignment Length:848 Identity:174/848 - (20%)
Similarity:268/848 - (31%) Gaps:313/848 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SAQRRTLATKVRRKGPRP---QRRLH-----PPL-----RPRLPLHLHLLLWLLCCCSQLGQLRA 77
            |:.::...||..|. |||   .:.|:     ||:     ||.:|:                    
Human   328 SSNKQPKPTKQPRT-PRPPSTSQALYPGPNQPPIAPYQTRPPIPI-------------------- 371

  Fly    78 ECPAVCECKWKSGK--ESVLCLNANLTHI----PQPLDAGTQLLDLSGNEIQLIPDDSFATAQLL 136
            .||..|.|......  .:|.|......:|    |:||:|  :.|.||.|.||.|....|.....|
Human   372 ICPTGCTCNLHINDLGLTVNCKERGFNNISELLPRPLNA--KKLYLSSNLIQKIYRSDFWNFSSL 434

  Fly   137 NLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPD 201
            :|  ::|....:..::..||..|.||..|.|:.|.:..:.......:..|..|....|.|..:..
Human   435 DL--LHLGNNRISYVQDGAFINLPNLKSLFLNGNDIEKLTPGMFRGLQSLHYLYFEFNVIREIQP 497

  Fly   202 DAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVR-SGTITSLASLHGLELA 265
            .||..:|.|..|.|::..|..:...||||  :||..|.|..|....:. :|.:..|.::..::|.
Human   498 AAFSLMPNLKLLFLNNNLLRTLPTDAFAG--TSLARLNLRKNYFLYLPVAGVLEHLNAIVQIDLN 560

  Fly   266 RNTWNCSCSLRPLRAWMLQQNIPSGIPPT-CESPPRLSGRAWDKLDVDDFACVPQIVATDTTAHG 329
            .|.|:|:|.|.|.:.|:...:..|.:... |.||..|:.|  |...::.....|:::..      
Human   561 ENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTHR--DVRTIELEVLCPEMLHV------ 617

  Fly   330 VEGRNITMSCYVEGVPQPAVKWLLKNRLIANLSAGGDGDSDSEPRTAAATQGRKTYVVNMLRNAS 394
                            .||                  |:|.::|..:                  
Human   618 ----------------APA------------------GESPAQPGDS------------------ 630

  Fly   395 NLTILTADMQDAGIYTCAAENKAGKVEASVTLAVSRRPPEAPWGVRIILLGAVA---ALLLVGGS 456
                          :...|...|...|.|        ||..|..:.:::|..:.   :.:.|...
Human   631 --------------HLIGAPTSASPYEFS--------PPGGPVPLSVLILSLLVLFFSAVFVAAG 673

  Fly   457 SFAAICLCSLQRRRKLRLWNSVPPVRRSESYEKIEMTA------RTRPDLGGGASCGGGSATGAG 515
            .||.:    |:||||     .:|  .||:..|.:::|.      |...|.|||   ||||..|..
Human   674 LFAYV----LRRRRK-----KLP--FRSKRQEGVDLTGIQMQCHRLFEDGGGG---GGGSGGGGR 724

  Fly   516 LFHDAEEQG--------YLRAAHTPLNDN------DAGQAAAIVNPSAGSAQRRN--------GD 558
            ....:.|:.        |:....|.:.:|      :..:.|......||||:|..        |:
Human   725 PTLSSPEKAPPVGHVYEYIPHPVTQMCNNPIYKPREEEEVAVSSAQEAGSAERGGPGTQPPGMGE 789

  Fly   559 YL---------------HVSTHCDDEEE------DQQL-------HHHPQQQPASQHHPHPNQQ- 594
            .|               :..|..:.|:|      ..||       ||||       |||..... 
Human   790 ALLGSEQFAETPKENHSNYRTLLEKEKEWALAVSSSQLNTIVTVNHHHP-------HHPAVGGVS 847

  Fly   595 -------------QHQQRKGSQGHVVSASGANNSAPLEETDLHIPRLIDIGGTDSASSSIS-SQV 645
                         :|.::.|  |.|:...|                    ||..|.|..:. .:.
Human   848 GVVGGTGGDLAGFRHHEKNG--GVVLFPPG--------------------GGCGSGSMLLDRERP 890

  Fly   646 DAAARLAGYAGHTWKTTPIATTKINSPHSKPVTSAAPSSLNTQATPYAHYGNHPADEMATSVFCS 710
            ..|....|:....:.|.|    |:...|..|                                  
Human   891 QPAPCTVGFVDCLYGTVP----KLKELHVHP---------------------------------- 917

  Fly   711 EGQESDLFDSNYPDLLDIAKYAVAQAQQEGR---------GQGYAQATTTPNGGLCTLPRKLKTS 766
            .|.:       ||||           ||:.|         |:|:....|..:..| .|..||:|.
Human   918 PGMQ-------YPDL-----------QQDARLKETLLFSAGKGFTDHQTQKSDYL-ELRAKLQTK 963

  Fly   767 GKY 769
            ..|
Human   964 PDY 966

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 43/157 (27%)
leucine-rich repeat 112..137 CDD:275380 8/24 (33%)
LRR_8 137..196 CDD:290566 13/58 (22%)
leucine-rich repeat 138..161 CDD:275380 5/22 (23%)
leucine-rich repeat 162..185 CDD:275380 4/22 (18%)
LRR_8 184..245 CDD:290566 20/60 (33%)
leucine-rich repeat 186..209 CDD:275380 6/22 (27%)
leucine-rich repeat 210..234 CDD:275380 8/23 (35%)
leucine-rich repeat 235..258 CDD:275380 6/23 (26%)
LRRCT 267..316 CDD:214507 14/49 (29%)
IG_like 328..428 CDD:214653 9/99 (9%)
Ig 335..425 CDD:143165 9/89 (10%)
SLITRK3NP_001305739.1 leucine-rich repeat 81..102 CDD:275380
leucine-rich repeat 103..126 CDD:275380
LRR_8 105..161 CDD:316378
leucine-rich repeat 127..150 CDD:275380
LRR_8 150..208 CDD:316378
leucine-rich repeat 151..174 CDD:275380
leucine-rich repeat 175..197 CDD:275380
leucine-rich repeat 198..402 CDD:275380 20/94 (21%)
leucine-rich repeat 224..271 CDD:275380
LRRCT 232..>270 CDD:214507
leucine-rich repeat 272..410 CDD:275380 23/102 (23%)
leucine-rich repeat 403..433 CDD:275380 12/31 (39%)
LRR_8 432..492 CDD:316378 14/61 (23%)
leucine-rich repeat 434..457 CDD:275380 6/24 (25%)
leucine-rich repeat 458..481 CDD:275380 4/22 (18%)
leucine-rich repeat 482..501 CDD:275380 5/18 (28%)
leucine-rich repeat 506..528 CDD:275380 8/23 (35%)
leucine-rich repeat 529..553 CDD:275380 6/23 (26%)
LRRCT 562..>597 CDD:214507 11/34 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.