DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and Lrfn4

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_700437.2 Gene:Lrfn4 / 225875 MGIID:2385612 Length:636 Species:Mus musculus


Alignment Length:430 Identity:114/430 - (26%)
Similarity:158/430 - (36%) Gaps:120/430 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LLLWLLCCCSQLGQLRAECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLI 125
            |||.||...:      |.||..|.|:..|...|.||.:..|..:|..:|..|..|.|:.|.||.:
Mouse     5 LLLLLLASGA------AACPLPCVCQNLSESLSTLCAHRGLLFVPPNVDRRTVELRLADNFIQAL 63

  Fly   126 -PDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELREL 189
             |.|                           ||.:..||:|.||:|.::.|.:.:...:..||.|
Mouse    64 GPPD---------------------------FRNMTGLVDLTLSRNAITRIGARSFGDLESLRSL 101

  Fly   190 RLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTIT 254
            .|.||.::.:...:......|..|.||..:|..||..||.....|||.|.:..|.|.:|....|.
Mouse   102 HLDGNRLVELGSSSLRGPVNLQHLILSGNQLGRIAPGAFDDFLDSLEDLDVSYNNLRQVPWAGIG 166

  Fly   255 SLASLHGLEL------------------------------------------------------- 264
            |:.:||.|.|                                                       
Mouse   167 SMPALHTLNLDHNLIDALPPGVFAQLSQLSRLDLTSNRLATLAPDPLFSRGRDAEASPSPLVLSF 231

  Fly   265 ARNTWNCSCSLRPLRAWMLQQNIPSGIPPTCESPPRLSGRAWDKLDVDDFACVPQIVATDTTAHG 329
            :.|..:|:|.|    .|:.:...|..: .||.|||.|:||.:..:...:|:|.|.::|..|....
Mouse   232 SGNPLHCNCEL----LWLRRLARPDDL-ETCASPPTLAGRYFWAVPEGEFSCEPPLIARHTQRLW 291

  Fly   330 V-EGRNITMSCYVEGVPQPAVKWL-LKNRLIANLSAGGDGDSDSEPRTAAATQGRKTYVVNMLRN 392
            | ||:..|:.|...|.|.|.:.|: ..:||:.|.|           |..|...|           
Mouse   292 VLEGQRATLRCRALGDPVPTMHWVGPDDRLVGNSS-----------RAWAFPNG----------- 334

  Fly   393 ASNLTILTADMQDAGIYTCAAENKAGKVEASVTLAVSRRP 432
              .|.|......|||.|||.|.|.||:..|.|.|.|...|
Mouse   335 --TLEIGVTGAGDAGAYTCIATNPAGEATARVELRVLALP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 45/212 (21%)
leucine-rich repeat 112..137 CDD:275380 8/25 (32%)
LRR_8 137..196 CDD:290566 15/58 (26%)
leucine-rich repeat 138..161 CDD:275380 2/22 (9%)
leucine-rich repeat 162..185 CDD:275380 7/22 (32%)
LRR_8 184..245 CDD:290566 20/60 (33%)
leucine-rich repeat 186..209 CDD:275380 6/22 (27%)
leucine-rich repeat 210..234 CDD:275380 9/23 (39%)
leucine-rich repeat 235..258 CDD:275380 8/22 (36%)
LRRCT 267..316 CDD:214507 15/48 (31%)
IG_like 328..428 CDD:214653 31/101 (31%)
Ig 335..425 CDD:143165 26/90 (29%)
Lrfn4NP_700437.2 LRR 39..>205 CDD:227223 48/192 (25%)
LRR 1 49..70 9/47 (19%)
leucine-rich repeat 50..73 CDD:275380 10/49 (20%)
LRR 2 73..94 7/20 (35%)
leucine-rich repeat 74..97 CDD:275380 7/22 (32%)
LRR 3 97..118 6/20 (30%)
leucine-rich repeat 98..121 CDD:275380 6/22 (27%)
LRR 4 121..142 9/20 (45%)
leucine-rich repeat 122..146 CDD:275380 9/23 (39%)
LRR 5 146..169 9/22 (41%)
leucine-rich repeat 147..170 CDD:275380 8/22 (36%)
LRR 6 170..191 4/20 (20%)
leucine-rich repeat 171..194 CDD:275380 4/22 (18%)
LRR 7 194..215 0/20 (0%)
leucine-rich repeat 195..213 CDD:275380 0/17 (0%)
LRRCT 234..278 CDD:214507 15/48 (31%)
Ig 295..368 CDD:386229 29/96 (30%)
fn3 409..478 CDD:365830
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..585
PDZ-binding 633..636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.