DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and Tpbg

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_001158264.1 Gene:Tpbg / 21983 MGIID:1341264 Length:426 Species:Mus musculus


Alignment Length:312 Identity:84/312 - (26%)
Similarity:125/312 - (40%) Gaps:66/312 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 CPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFA-TAQLLNLQKVY 142
            |||.|||  .....:|.|:|.||..:|..|....:.|.|:||::.::|..:|| ...|.:|:.:.
Mouse    62 CPAACEC--SEAARTVKCVNRNLLEVPADLPPYVRNLFLTGNQMTVLPAGAFARQPPLADLEALN 124

  Fly   143 LARCHLRLIERHAFRKLINLVELDLSQNLL------------------SAIPSLALYHV------ 183
            |:..||:.:...||..|..|..||||.|.|                  |.:..|.|.|:      
Mouse   125 LSGNHLKEVCAGAFEHLPGLRRLDLSHNPLTNLSAFAFAGSNASVSAPSPLEELILNHIVPPEDQ 189

  Fly   184 --------------------------SELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSH 222
                                      ..|..|.|:.|..|.:|.|....:|.|..|:|.:..|..
Mouse   190 RQNGSFEGMVAFEGMVAAALRSGLALRGLTRLELASNHFLFLPRDLLAQLPSLRYLDLRNNSLVS 254

  Fly   223 IAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLE-----LARNTWNCSCSLRPLRAWM 282
            :...:|..| :.||.|.|:.|.|..:.:.|   ||..|||.     |..|.|.|.|.:..:.||:
Mouse   255 LTYASFRNL-THLESLHLEDNALKVLHNST---LAEWHGLAHVKVFLDNNPWVCDCYMADMVAWL 315

  Fly   283 LQ-QNIPSGIPPTCESPPRLSGRAWDKLDVDDFAC---VPQIVATDTTAHGV 330
            .: :.:|.....||..|.::..|....|:..|..|   :||.:.|.....|:
Mouse   316 KETEVVPDKARLTCAFPEKMRNRGLLDLNSSDLDCDAVLPQSLQTSYVFLGI 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 53/212 (25%)
leucine-rich repeat 112..137 CDD:275380 8/25 (32%)
LRR_8 137..196 CDD:290566 22/108 (20%)
leucine-rich repeat 138..161 CDD:275380 7/22 (32%)
leucine-rich repeat 162..185 CDD:275380 11/72 (15%)
LRR_8 184..245 CDD:290566 19/60 (32%)
leucine-rich repeat 186..209 CDD:275380 7/22 (32%)
leucine-rich repeat 210..234 CDD:275380 6/23 (26%)
leucine-rich repeat 235..258 CDD:275380 8/22 (36%)
LRRCT 267..316 CDD:214507 13/49 (27%)
IG_like 328..428 CDD:214653 1/3 (33%)
Ig 335..425 CDD:143165
TpbgNP_001158264.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..53
LRRNT 62..95 CDD:214470 13/34 (38%)
leucine-rich repeat 73..95 CDD:275380 7/21 (33%)
LRR 1 92..113 6/20 (30%)
LRR_8 93..154 CDD:338972 21/60 (35%)
leucine-rich repeat 96..119 CDD:275380 8/22 (36%)
LRR 2 116..139 6/22 (27%)
leucine-rich repeat 120..143 CDD:275380 7/22 (32%)
LRR 3 141..163 8/21 (38%)
leucine-rich repeat 144..167 CDD:275380 7/22 (32%)
LRR 4 172..210 4/37 (11%)
leucine-rich repeat 175..217 CDD:275380 3/41 (7%)
LRR 5 215..238 7/22 (32%)
LRR_8 217..276 CDD:338972 19/59 (32%)
leucine-rich repeat 218..241 CDD:275380 7/22 (32%)
LRR 6 239..261 5/21 (24%)
leucine-rich repeat 242..265 CDD:275380 6/23 (26%)
LRR 7 262..281 7/19 (37%)
leucine-rich repeat 266..289 CDD:275380 9/25 (36%)
LRRCT 300..351 CDD:214507 13/50 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.