| Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001911.1 | Gene: | DCN / 1634 | HGNCID: | 2705 | Length: | 359 | Species: | Homo sapiens |
| Alignment Length: | 244 | Identity: | 72/244 - (29%) |
|---|---|---|---|
| Similarity: | 105/244 - (43%) | Gaps: | 40/244 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 79 CPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQKVYL 143
Fly 144 ARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVP 208
Fly 209 QLVKLEL--SDCRLSHIAVRAFAGLES--------------------SLEWLKLDGNRLSEVRSG 251
Fly 252 TITSLASLHGLELARNTW----NCSCSLRP-LRAWMLQQN----IPSGI 291 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 53/178 (30%) |
| leucine-rich repeat | 112..137 | CDD:275380 | 11/24 (46%) | ||
| LRR_8 | 137..196 | CDD:290566 | 18/58 (31%) | ||
| leucine-rich repeat | 138..161 | CDD:275380 | 5/22 (23%) | ||
| leucine-rich repeat | 162..185 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 184..245 | CDD:290566 | 23/82 (28%) | ||
| leucine-rich repeat | 186..209 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 210..234 | CDD:275380 | 7/45 (16%) | ||
| leucine-rich repeat | 235..258 | CDD:275380 | 9/22 (41%) | ||
| LRRCT | 267..316 | CDD:214507 | 10/34 (29%) | ||
| IG_like | 328..428 | CDD:214653 | |||
| Ig | 335..425 | CDD:143165 | |||
| DCN | NP_001911.1 | LRRNT | 54..80 | CDD:279764 | 8/29 (28%) |
| leucine-rich repeat | 62..82 | CDD:275380 | 5/23 (22%) | ||
| NEL | <70..>298 | CDD:330839 | 66/224 (29%) | ||
| LRR 1 | 73..93 | 8/19 (42%) | |||
| leucine-rich repeat | 83..106 | CDD:275380 | 11/24 (46%) | ||
| LRR 2 | 94..117 | 7/24 (29%) | |||
| leucine-rich repeat | 107..130 | CDD:275380 | 5/22 (23%) | ||
| LRR 3 | 118..141 | 8/22 (36%) | |||
| leucine-rich repeat | 131..151 | CDD:275380 | 7/22 (32%) | ||
| LRR 4 | 142..162 | 6/22 (27%) | |||
| leucine-rich repeat | 152..175 | CDD:275380 | 8/22 (36%) | ||
| LRR 5 | 163..186 | 5/22 (23%) | |||
| leucine-rich repeat | 176..201 | CDD:275380 | 7/24 (29%) | ||
| LRR 6 | 187..212 | 5/24 (21%) | |||
| leucine-rich repeat | 202..222 | CDD:275380 | 0/19 (0%) | ||
| LRR 7 | 213..233 | 7/19 (37%) | |||
| leucine-rich repeat | 223..246 | CDD:275380 | 9/22 (41%) | ||
| LRR 8 | 234..257 | 7/22 (32%) | |||
| leucine-rich repeat | 247..270 | CDD:275380 | 6/22 (27%) | ||
| LRR 9 | 258..281 | 7/22 (32%) | |||
| LRR 10 | 282..304 | 2/7 (29%) | |||
| leucine-rich repeat | 294..313 | CDD:275380 | |||
| LRR 11 | 305..334 | ||||
| LRR 12 | 335..359 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||