DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and CHADL

DIOPT Version :10

Sequence 1:NP_523575.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_054181131.1 Gene:CHADL / 150356 HGNCID:25165 Length:771 Species:Homo sapiens


Alignment Length:610 Identity:158/610 - (25%)
Similarity:223/610 - (36%) Gaps:151/610 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KGPRPQRRLHPPLRPRLPLHLHLLLWLLCCCSQLGQLRAECPAVCECKWKSGKESVLCLNANLTH 103
            :|||..  .|.||  .|||   |:|.||....|....|  ||..|.|  .:.:..|.|...|||.
Human     2 EGPRSS--THVPL--VLPL---LVLLLLAPARQAAAQR--CPQACIC--DNSRRHVACRYQNLTE 55

  Fly   104 IPQPLDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLS 168
            :|..:...||.|||.||.:::||..:|....  :|..:.|..|.:.|:...|||.|..|:.|:|:
Human    56 VPDAIPELTQRLDLQGNLLKVIPAAAFQGVP--HLTHLDLRHCEVELVAEGAFRGLGRLLLLNLA 118

  Fly   169 QNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLES 233
            .|.|..:|..||..:..||.|.|.||.:..:....||.:..|..|.|:...|.::...||.|| .
Human   119 SNHLRELPQEALDGLGSLRRLELEGNALEELRPGTFGALGALATLNLAHNALVYLPAMAFQGL-L 182

  Fly   234 SLEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQQ-----NIPSGIPP 293
            .:.||:|..|.||.:....:..|.:|..|.|..|      .|:.|...:|.|     .:..|..|
Human   183 RVRWLRLSHNALSVLAPEALAGLPALRRLSLHHN------ELQALPGPVLSQARGLARLELGHNP 241

  Fly   294 TCESPPR------------LSGRAWDKLDVDDFACVPQIVATD------TTAHGVEGRNITMSCY 340
            ...:...            |.|.|...|....||..|::...|      .|...::|........
Human   242 LTYAGEEDGLALPGLRELLLDGGALQALGPRAFAHCPRLHTLDLRGNQLDTLPPLQGPGQLRRLR 306

  Fly   341 VEGVP-------QPAVKWLLKNRLIANLSAGGDGDSDSEPRTAAATQGRKTYVVNMLRNASNLTI 398
            ::|.|       :|.::||.:.|:                |:..|.||.:     .||..:...:
Human   307 LQGNPLWCGCQARPLLEWLARARV----------------RSDGACQGPR-----RLRGEALDAL 350

  Fly   399 LTADMQDAGIYTCAAENKAGKVEASVT--LAVSRRPPEAPWGVRIILLGAVA----ALLLVGGSS 457
            ...|::..|   .||:.:....|.:|.  .|..|.||..|...|     |||    |.:.|..|.
Human   351 RPWDLRCPG---DAAQEEEELEERAVAGPRAPPRGPPRGPGEER-----AVAPCPRACVCVPESR 407

  Fly   458 FAAICLCSLQR--------------RRKLRLWNSVPPVRRSESYEKIEMTARTRPDLGGGAS--- 505
            .::...|.||.              ||     |..|.|.|:           ..|.||...|   
Human   408 HSSCEGCGLQAVPRGFPSDTQLLDLRR-----NHFPSVPRA-----------AFPGLGHLVSLHL 456

  Fly   506 --CG-----GGSATGAGLFHDAEEQGYLRAAHTPLNDND-AGQAAAIVN--PSAGSAQRRNGDYL 560
              ||     .|:..|.|           |..:..|:||. ||.:||.:.  |..|........:|
Human   457 QHCGIAELEAGALAGLG-----------RLIYLYLSDNQLAGLSAAALEGAPRLGYLYLERNRFL 510

  Fly   561 HV------------STHCDDEEEDQ 573
            .|            |.|..|...|:
Human   511 QVPGAALRALPSLFSLHLQDNAVDR 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_523575.1 LRR <98..>267 CDD:443914 56/168 (33%)
leucine-rich repeat 112..137 CDD:275380 10/24 (42%)
leucine-rich repeat 138..161 CDD:275380 8/22 (36%)
leucine-rich repeat 162..185 CDD:275380 8/22 (36%)
leucine-rich repeat 186..209 CDD:275380 8/22 (36%)
leucine-rich repeat 210..234 CDD:275380 8/23 (35%)
leucine-rich repeat 235..258 CDD:275380 7/22 (32%)
LRRCT 267..316 CDD:214507 12/65 (18%)
Ig 331..428 CDD:472250 19/105 (18%)
Ig strand B 335..339 CDD:409562 0/3 (0%)
Ig strand C 348..352 CDD:409562 0/3 (0%)
Ig strand E 394..398 CDD:409562 0/3 (0%)
Ig strand F 408..413 CDD:409562 0/4 (0%)
Ig strand G 421..424 CDD:409562 1/2 (50%)
CHADLXP_054181131.1 LRRNT 33..65 CDD:214470 10/33 (30%)
leucine-rich repeat 44..62 CDD:275380 6/17 (35%)
leucine-rich repeat 64..87 CDD:275380 10/24 (42%)
LRR_8 65..146 CDD:404697 31/82 (38%)
leucine-rich repeat 88..135 CDD:275380 16/46 (35%)
LRR <128..>312 CDD:443914 46/190 (24%)
leucine-rich repeat 136..159 CDD:275380 8/22 (36%)
leucine-rich repeat 160..183 CDD:275380 8/23 (35%)
leucine-rich repeat 184..207 CDD:275380 7/22 (32%)
leucine-rich repeat 208..231 CDD:275380 8/28 (29%)
leucine-rich repeat 232..255 CDD:275380 2/22 (9%)
leucine-rich repeat 256..279 CDD:275380 6/22 (27%)
LRRNT 395..429 CDD:214470 6/33 (18%)
leucine-rich repeat 410..426 CDD:275380 3/15 (20%)
leucine-rich repeat 427..450 CDD:275380 8/38 (21%)
LRR <445..>677 CDD:443914 25/102 (25%)
leucine-rich repeat 451..474 CDD:275380 6/33 (18%)
leucine-rich repeat 475..498 CDD:275380 7/22 (32%)
leucine-rich repeat 499..522 CDD:275380 3/22 (14%)
leucine-rich repeat 523..546 CDD:275380 4/13 (31%)
leucine-rich repeat 547..570 CDD:275380
leucine-rich repeat 571..594 CDD:275380
leucine-rich repeat 595..619 CDD:275380
leucine-rich repeat 620..644 CDD:275380
LRRCT 675..723 CDD:214507
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.