DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and CHADL

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_011528235.1 Gene:CHADL / 150356 HGNCID:25165 Length:830 Species:Homo sapiens


Alignment Length:393 Identity:96/393 - (24%)
Similarity:136/393 - (34%) Gaps:135/393 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LEAPGPPSGQDIASDNSAQRRTLATKVRRKGPRPQRRLHPPLRPRLPLHLHLLLWLLCCCSQLGQ 74
            |..||..:.:    :...:.|.:|      |||...| .||..|                   |:
Human   423 LRCPGDAAQE----EEELEERAVA------GPRAPPR-GPPRGP-------------------GE 457

  Fly    75 LR--AECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQLLN 137
            .|  |.||..|.|..:|...|  |....|..:|:...:.||||||..|....:|..:|  ..|.:
Human   458 ERAVAPCPRACVCVPESRHSS--CEGCGLQAVPRGFPSDTQLLDLRRNHFPSVPRAAF--PGLGH 518

  Fly   138 LQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLS----------------------------- 173
            |..::|..|.:..:|..|...|..|:.|.||.|.|:                             
Human   519 LVSLHLQHCGIAELEAGALAGLGRLIYLYLSDNQLAGLSAAALEGAPRLGYLYLERNRFLQVPGA 583

  Fly   174 ---AIPSLALYHVSE----------------LRELRLSGNPILRVPDDAFGHVPQLVKLELSDCR 219
               |:|||...|:.:                ||.:.||||.|..|...|.|...:|.||.|...:
Human   584 ALRALPSLFSLHLQDNAVDRLAPGDLGRTRALRWVYLSGNRITEVSLGALGPARELEKLHLDRNQ 648

  Fly   220 LSHIAVRAFAGLESSLEWLKLDGNRLSEVRSG--------------------------------- 251
            |..:...|..||.:.|| |:|.||.|..:|.|                                 
Human   649 LREVPTGALEGLPALLE-LQLSGNPLRALRDGAFQPVGRSLQHLFLNSSGLEQICPGAFSGLGPG 712

  Fly   252 ---------------TITSLASLHGLELARNTWNCSCSLRPLRAWMLQQNIPSGIPPTCESPPRL 301
                           .:.||:.|..::|:.|.::|.|.|.||..|:...|:..|  .||.:||..
Human   713 LQSLHLQKNQLRALPALPSLSQLELIDLSSNPFHCDCQLLPLHRWLTGLNLRVG--ATCATPPNA 775

  Fly   302 SGR 304
            .|:
Human   776 RGQ 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 58/252 (23%)
leucine-rich repeat 112..137 CDD:275380 10/24 (42%)
LRR_8 137..196 CDD:290566 23/106 (22%)
leucine-rich repeat 138..161 CDD:275380 6/22 (27%)
leucine-rich repeat 162..185 CDD:275380 11/54 (20%)
LRR_8 184..245 CDD:290566 24/76 (32%)
leucine-rich repeat 186..209 CDD:275380 10/22 (45%)
leucine-rich repeat 210..234 CDD:275380 8/23 (35%)
leucine-rich repeat 235..258 CDD:275380 11/70 (16%)
LRRCT 267..316 CDD:214507 14/38 (37%)
IG_like 328..428 CDD:214653
Ig 335..425 CDD:143165
CHADLXP_011528235.1 leucine-rich repeat 132..155 CDD:275380
LRR_RI <133..358 CDD:238064
LRR_8 133..214 CDD:290566
leucine-rich repeat 156..179 CDD:275380
leucine-rich repeat 180..203 CDD:275380
leucine-rich repeat 204..227 CDD:275380
LRR_8 228..286 CDD:290566
leucine-rich repeat 228..251 CDD:275380
leucine-rich repeat 252..275 CDD:275380
leucine-rich repeat 276..299 CDD:275380
leucine-rich repeat 300..323 CDD:275380
LRR_8 322..380 CDD:290566
leucine-rich repeat 324..347 CDD:275380
LRR_4 346..>380 CDD:289563
LRRNT 463..497 CDD:214470 10/35 (29%)
leucine-rich repeat 478..494 CDD:275380 4/17 (24%)
LRR_RI 492..671 CDD:238064 49/181 (27%)
leucine-rich repeat 495..518 CDD:275380 10/24 (42%)
LRR_8 518..577 CDD:290566 12/58 (21%)
leucine-rich repeat 519..542 CDD:275380 6/22 (27%)
leucine-rich repeat 543..566 CDD:275380 6/22 (27%)
LRR_8 565..625 CDD:290566 11/59 (19%)
leucine-rich repeat 567..590 CDD:275380 1/22 (5%)
leucine-rich repeat 591..614 CDD:275380 2/22 (9%)
leucine-rich repeat 615..638 CDD:275380 10/22 (45%)
LRR_8 637..698 CDD:290566 17/61 (28%)
leucine-rich repeat 639..662 CDD:275380 8/22 (36%)
leucine-rich repeat 663..687 CDD:275380 9/24 (38%)
LRR_8 686..745 CDD:290566 5/58 (9%)
leucine-rich repeat 688..712 CDD:275380 0/23 (0%)
LRR_4 711..>744 CDD:289563 4/32 (13%)
LRRCT 743..791 CDD:214507 14/38 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141332
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.