DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and AgaP_AGAP002792

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_312123.5 Gene:AgaP_AGAP002792 / 1273171 VectorBaseID:AGAP002792 Length:332 Species:Anopheles gambiae


Alignment Length:367 Identity:87/367 - (23%)
Similarity:137/367 - (37%) Gaps:94/367 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DLSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLAL 180
            ||.||.|.:|.:..|  ..|..|:.:.|...|:..||:.|...||:|..||||.|.|:|:|..|.
Mosquito     9 DLQGNNISVIYESDF--QGLAKLRILQLTDNHIYTIEKDALHDLISLERLDLSHNALTAVPKRAF 71

  Fly   181 YHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRL 245
            .....||.|:|..|.|..:.:   |.|..|.:||:                      |.|:.|.:
Mosquito    72 KGAPALRSLQLDNNQITCLDE---GAVKGLTELEI----------------------LTLNNNNI 111

  Fly   246 SEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQ--QNIPSGIPPT-CESPPRLSGRAWD 307
            :.:.......:..|..|.|:.|.:.|.|.|    :|:.:  :|.....|.| |.||.:|.|:...
Mosquito   112 TTLPRDMFAGMPRLRALRLSENPFACDCHL----SWLARYLKNASRLAPYTRCHSPGQLKGQNVA 172

  Fly   308 KLDVDDFAC---------------------------------------VPQIVATDTTAHGVEGR 333
            .|...||.|                                       ||..:..|||...:|..
Mosquito   173 DLHEQDFKCSGKCADGQRERSVLIKVLCPHPCRCADGIVDCREKSLNTVPSTLPEDTTELRLEQN 237

  Fly   334 NITMSCYVEGVPQPA------VKWL-LKNRLIANLSAGGDGDSDSEPRTAAATQGR--KTYVVNM 389
                  |:..:|..|      :|.: |.|..|:.::.  |..|..:..|:....|.  |....::
Mosquito   238 ------YITEIPPKAFANHRRLKRIDLSNNNISRVAY--DAFSGLKSLTSLVLYGNKIKDLPASV 294

  Fly   390 LRNASNLTILTADMQDAGIYTCAAENKAGKVEASVTLAVSRR 431
            .:..::|.:|   :.:|...:|...: |.||..::.|....|
Mosquito   295 FKGLTSLQLL---LLNANEISCVRRD-AFKVPHNILLVCDNR 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 43/150 (29%)
leucine-rich repeat 112..137 CDD:275380 8/20 (40%)
LRR_8 137..196 CDD:290566 23/58 (40%)
leucine-rich repeat 138..161 CDD:275380 7/22 (32%)
leucine-rich repeat 162..185 CDD:275380 10/22 (45%)
LRR_8 184..245 CDD:290566 14/60 (23%)
leucine-rich repeat 186..209 CDD:275380 8/22 (36%)
leucine-rich repeat 210..234 CDD:275380 3/23 (13%)
leucine-rich repeat 235..258 CDD:275380 3/22 (14%)
LRRCT 267..316 CDD:214507 16/51 (31%)
IG_like 328..428 CDD:214653 21/108 (19%)
Ig 335..425 CDD:143165 19/98 (19%)
AgaP_AGAP002792XP_312123.5 LRR_8 <6..39 CDD:290566 10/31 (32%)
leucine-rich repeat 9..28 CDD:275380 8/20 (40%)
LRR_8 28..87 CDD:290566 23/58 (40%)
LRR_RI <29..154 CDD:238064 41/153 (27%)
leucine-rich repeat 29..52 CDD:275380 7/22 (32%)
leucine-rich repeat 53..76 CDD:275380 10/22 (45%)
LRR_8 75..135 CDD:290566 18/84 (21%)
leucine-rich repeat 77..100 CDD:275380 9/25 (36%)
leucine-rich repeat 101..124 CDD:275380 5/44 (11%)
leucine-rich repeat 125..153 CDD:275380 9/31 (29%)
LRRCT 133..182 CDD:214507 16/52 (31%)
leucine-rich repeat 154..252 CDD:275380 20/103 (19%)
leucine-rich repeat 166..217 CDD:275380 6/50 (12%)
LRRNT 200..231 CDD:214470 4/30 (13%)
LRR_8 230..287 CDD:290566 13/64 (20%)
LRR_4 252..292 CDD:289563 9/41 (22%)
leucine-rich repeat 253..276 CDD:275380 6/24 (25%)
leucine-rich repeat 277..297 CDD:275380 3/19 (16%)
leucine-rich repeat 301..320 CDD:275380 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.