| Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_309414.4 | Gene: | AgaP_AGAP011229 / 1270695 | VectorBaseID: | AGAP011229 | Length: | 398 | Species: | Anopheles gambiae |
| Alignment Length: | 245 | Identity: | 69/245 - (28%) |
|---|---|---|---|
| Similarity: | 102/245 - (41%) | Gaps: | 53/245 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 72 LGQLRAECPAVCECKWKSGKESV--LCLNANLTHIPQPLDAGT---------------------- 112
Fly 113 -QLLDLSGNEIQLIPDDSFATAQLL----------------------NLQKVYLARCHLRLIERH 154
Fly 155 AFRKLINLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVP-DDAFGHVPQ-LVKLELSD 217
Fly 218 CRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELARN 267 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 55/203 (27%) |
| leucine-rich repeat | 112..137 | CDD:275380 | 10/69 (14%) | ||
| LRR_8 | 137..196 | CDD:290566 | 20/58 (34%) | ||
| leucine-rich repeat | 138..161 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 162..185 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 184..245 | CDD:290566 | 22/62 (35%) | ||
| leucine-rich repeat | 186..209 | CDD:275380 | 7/23 (30%) | ||
| leucine-rich repeat | 210..234 | CDD:275380 | 9/23 (39%) | ||
| leucine-rich repeat | 235..258 | CDD:275380 | 9/22 (41%) | ||
| LRRCT | 267..316 | CDD:214507 | 1/1 (100%) | ||
| IG_like | 328..428 | CDD:214653 | |||
| Ig | 335..425 | CDD:143165 | |||
| AgaP_AGAP011229 | XP_309414.4 | leucine-rich repeat | 62..84 | CDD:275380 | 0/21 (0%) |
| leucine-rich repeat | 85..108 | CDD:275380 | 8/22 (36%) | ||
| LRR_RI | <108..289 | CDD:238064 | 47/157 (30%) | ||
| LRR_8 | 109..167 | CDD:290566 | 15/57 (26%) | ||
| leucine-rich repeat | 109..132 | CDD:275380 | 1/22 (5%) | ||
| leucine-rich repeat | 133..156 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 155..239 | CDD:290566 | 30/84 (36%) | ||
| leucine-rich repeat | 157..180 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 181..206 | CDD:275380 | 7/24 (29%) | ||
| leucine-rich repeat | 207..230 | CDD:275380 | 9/23 (39%) | ||
| LRR_8 | 229..289 | CDD:290566 | 12/36 (33%) | ||
| leucine-rich repeat | 231..254 | CDD:275380 | 9/22 (41%) | ||
| leucine-rich repeat | 255..278 | CDD:275380 | 3/9 (33%) | ||
| LRR_8 | 278..337 | CDD:290566 | |||
| leucine-rich repeat | 279..302 | CDD:275380 | |||
| leucine-rich repeat | 303..324 | CDD:275380 | |||
| leucine-rich repeat | 353..366 | CDD:275378 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||