| Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_443204.1 | Gene: | LRG1 / 116844 | HGNCID: | 29480 | Length: | 347 | Species: | Homo sapiens |
| Alignment Length: | 340 | Identity: | 87/340 - (25%) |
|---|---|---|---|
| Similarity: | 119/340 - (35%) | Gaps: | 96/340 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 52 RPRLP--LHLH----LLLWLLCCCSQLGQLRAECPAVCECKWKSGKESVLC---------LNA-- 99
Fly 100 --------NLTHIPQPLDAGT---------------------------QLLDLSGNEIQLIPDDS 129
Fly 130 F---ATAQLLNLQKVYL------------ARCHLRLIERHAFRKL--------INLVELDLSQNL 171
Fly 172 LSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLE 236
Fly 237 WLKLDGNRLSEVRSGTITSLASLH-----GLELARNTWNCSCSLRPLRAW-------MLQQNIPS 289
Fly 290 GIPPTCESPPRLSGR 304 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 53/211 (25%) |
| leucine-rich repeat | 112..137 | CDD:275380 | 8/54 (15%) | ||
| LRR_8 | 137..196 | CDD:290566 | 22/78 (28%) | ||
| leucine-rich repeat | 138..161 | CDD:275380 | 9/42 (21%) | ||
| leucine-rich repeat | 162..185 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 184..245 | CDD:290566 | 20/60 (33%) | ||
| leucine-rich repeat | 186..209 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 210..234 | CDD:275380 | 9/23 (39%) | ||
| leucine-rich repeat | 235..258 | CDD:275380 | 9/22 (41%) | ||
| LRRCT | 267..316 | CDD:214507 | 12/45 (27%) | ||
| IG_like | 328..428 | CDD:214653 | |||
| Ig | 335..425 | CDD:143165 | |||
| LRG1 | NP_443204.1 | LRR_8 | 79..128 | CDD:290566 | 11/48 (23%) |
| LRR_RI | <82..248 | CDD:238064 | 40/166 (24%) | ||
| LRR 1 | 93..114 | 0/20 (0%) | |||
| leucine-rich repeat | 94..117 | CDD:275380 | 0/22 (0%) | ||
| LRR_8 | 116..176 | CDD:290566 | 15/60 (25%) | ||
| LRR 2 | 117..138 | 6/20 (30%) | |||
| leucine-rich repeat | 118..141 | CDD:275380 | 6/22 (27%) | ||
| LRR 3 | 141..162 | 4/20 (20%) | |||
| leucine-rich repeat | 142..165 | CDD:275380 | 3/22 (14%) | ||
| LRR 4 | 165..186 | 7/21 (33%) | |||
| leucine-rich repeat | 166..189 | CDD:275380 | 6/23 (26%) | ||
| LRR_8 | 169..224 | CDD:290566 | 18/55 (33%) | ||
| LRR 5 | 189..210 | 8/20 (40%) | |||
| leucine-rich repeat | 190..213 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 213..272 | CDD:290566 | 20/59 (34%) | ||
| LRR 6 | 213..234 | 6/20 (30%) | |||
| leucine-rich repeat | 214..237 | CDD:275380 | 6/22 (27%) | ||
| LRR 7 | 237..258 | 7/20 (35%) | |||
| leucine-rich repeat | 238..261 | CDD:275380 | 9/23 (39%) | ||
| LRR 8 | 261..282 | 7/20 (35%) | |||
| leucine-rich repeat | 262..285 | CDD:275380 | 9/22 (41%) | ||
| LRRCT | 299..346 | CDD:214507 | 12/45 (27%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165141312 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||