| Sequence 1: | NP_001162986.1 | Gene: | kek3 / 34912 | FlyBaseID: | FBgn0028370 | Length: | 1021 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_766259.2 | Gene: | Lgr4 / 107515 | MGIID: | 1891468 | Length: | 951 | Species: | Mus musculus |
| Alignment Length: | 256 | Identity: | 85/256 - (33%) |
|---|---|---|---|
| Similarity: | 115/256 - (44%) | Gaps: | 15/256 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 55 LPLHLHLL----LWLLCCCSQLGQLRAECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLL 115
Fly 116 DLSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLAL 180
Fly 181 YHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRL 245
Fly 246 SEVRSGTITSLASLHGLELARN-----TWNCSCSLRPLRAWMLQQNIPSGIPPTCESPPRL 301 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| kek3 | NP_001162986.1 | LRR_RI | <110..267 | CDD:238064 | 57/156 (37%) |
| leucine-rich repeat | 112..137 | CDD:275380 | 10/24 (42%) | ||
| LRR_8 | 137..196 | CDD:290566 | 21/58 (36%) | ||
| leucine-rich repeat | 138..161 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 162..185 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 184..245 | CDD:290566 | 24/60 (40%) | ||
| leucine-rich repeat | 186..209 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 210..234 | CDD:275380 | 8/23 (35%) | ||
| leucine-rich repeat | 235..258 | CDD:275380 | 7/22 (32%) | ||
| LRRCT | 267..316 | CDD:214507 | 9/40 (23%) | ||
| IG_like | 328..428 | CDD:214653 | |||
| Ig | 335..425 | CDD:143165 | |||
| Lgr4 | NP_766259.2 | LRRNT | 29..61 | CDD:214470 | 13/34 (38%) |
| LRR 1 | 58..79 | 10/20 (50%) | |||
| leucine-rich repeat | 59..82 | CDD:275380 | 10/22 (45%) | ||
| LRR 2 | 82..103 | 6/22 (27%) | |||
| LRR_RI | 83..375 | CDD:238064 | 55/169 (33%) | ||
| LRR_8 | 83..141 | CDD:290566 | 21/57 (37%) | ||
| leucine-rich repeat | 83..106 | CDD:275380 | 7/22 (32%) | ||
| LRR 3 | 106..127 | 8/20 (40%) | |||
| leucine-rich repeat | 107..130 | CDD:275380 | 8/22 (36%) | ||
| LRR 4 | 130..151 | 10/20 (50%) | |||
| leucine-rich repeat | 131..154 | CDD:275380 | 10/22 (45%) | ||
| LRR 5 | 154..177 | 9/23 (39%) | |||
| leucine-rich repeat | 155..178 | CDD:275380 | 8/23 (35%) | ||
| LRR_8 | 177..237 | CDD:290566 | 17/59 (29%) | ||
| LRR 6 | 178..199 | 5/20 (25%) | |||
| leucine-rich repeat | 179..202 | CDD:275380 | 7/22 (32%) | ||
| LRR 7 | 202..223 | 6/20 (30%) | |||
| leucine-rich repeat | 203..226 | CDD:275380 | 6/22 (27%) | ||
| LRR 8 | 226..247 | 4/20 (20%) | |||
| leucine-rich repeat | 227..249 | CDD:275380 | 4/21 (19%) | ||
| LRR_8 | 248..305 | CDD:290566 | 2/3 (67%) | ||
| LRR 9 | 249..270 | 1/2 (50%) | |||
| leucine-rich repeat | 250..273 | CDD:275380 | 1/1 (100%) | ||
| LRR_8 | 272..355 | CDD:290566 | |||
| LRR 10 | 273..294 | ||||
| leucine-rich repeat | 274..295 | CDD:275380 | |||
| LRR 11 | 320..341 | ||||
| leucine-rich repeat | 321..344 | CDD:275380 | |||
| LRR 12 | 344..365 | ||||
| leucine-rich repeat | 345..366 | CDD:275380 | |||
| LRR_8 | 365..425 | CDD:290566 | |||
| LRR 13 | 366..387 | ||||
| leucine-rich repeat | 367..390 | CDD:275380 | |||
| LRR | 388..410 | CDD:197688 | |||
| LRR 14 | 390..411 | ||||
| leucine-rich repeat | 391..414 | CDD:275380 | |||
| LRR 15 | 414..435 | ||||
| leucine-rich repeat | 415..438 | CDD:275380 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 487..512 | ||||
| 7tm_1 | 556..801 | CDD:278431 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167831259 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||