DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and lrrc17

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_004913080.1 Gene:lrrc17 / 101732309 XenbaseID:XB-GENE-1010987 Length:428 Species:Xenopus tropicalis


Alignment Length:293 Identity:69/293 - (23%)
Similarity:104/293 - (35%) Gaps:93/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LLWLLCCCSQLGQLRAECPAVCEC-KWKSGKESVLCLNANLT---------HIP-QPLDAGTQLL 115
            ||.|||.|.           :.|| |.||.:|:.   ..|.|         :.| .|.:....| 
 Frog     6 LLMLLCFCK-----------ISECRKTKSNRENG---KPNRTKKTSSTVKRYAPGLPCETYIYL- 55

  Fly   116 DLSGNEIQLIPDDSFATAQL----LNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIP 176
                ||..|...:...|:.|    .:|..:.|||..:|:::.:||.|...:..|||.||.:..|.
 Frog    56 ----NEKYLDCQEKRQTSVLPAWPEDLIHILLARNLIRILKNNAFSKFQKVKSLDLQQNEIIKIE 116

  Fly   177 SLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLD 241
            :||.|.:..|..|.|..|.|..:.::.|.|:|.|..|.|.|                        
 Frog   117 NLAFYGLKRLTTLLLQHNKIKVLSEEVFIHLPLLSYLRLYD------------------------ 157

  Fly   242 GNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWM-LQQNIPSGIPPTCESPPRLSGRA 305
                                     |.|:|:|.|..|...: :.:|...|....||:|..:.|..
 Frog   158 -------------------------NPWDCNCELESLVTLLKIPRNRNLGNYAKCETPIEMKGLK 197

  Fly   306 WDKLDVDDFACVPQIVATDTT--AHGVEGRNIT 336
            ...:.       |:::..|.|  ...:||..:|
 Frog   198 LKTVS-------PELICQDRTMEPQHIEGPKVT 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 35/160 (22%)
leucine-rich repeat 112..137 CDD:275380 6/28 (21%)
LRR_8 137..196 CDD:290566 21/58 (36%)
leucine-rich repeat 138..161 CDD:275380 8/22 (36%)
leucine-rich repeat 162..185 CDD:275380 9/22 (41%)
LRR_8 184..245 CDD:290566 12/60 (20%)
leucine-rich repeat 186..209 CDD:275380 7/22 (32%)
leucine-rich repeat 210..234 CDD:275380 4/23 (17%)
leucine-rich repeat 235..258 CDD:275380 0/22 (0%)
LRRCT 267..316 CDD:214507 12/49 (24%)
IG_like 328..428 CDD:214653 3/9 (33%)
Ig 335..425 CDD:143165 1/2 (50%)
lrrc17XP_004913080.1 leucine-rich repeat 58..77 CDD:275380 3/18 (17%)
leucine-rich repeat 78..101 CDD:275380 8/22 (36%)
LRR <86..>319 CDD:227223 43/194 (22%)
LRR_8 101..159 CDD:338972 21/106 (20%)
leucine-rich repeat 102..125 CDD:275380 9/22 (41%)
leucine-rich repeat 126..149 CDD:275380 7/22 (32%)
leucine-rich repeat 150..211 CDD:275380 18/116 (16%)
leucine-rich repeat 212..259 CDD:275380 3/12 (25%)
leucine-rich repeat 260..283 CDD:275380
LRR_8 262..316 CDD:338972
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..331 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.