DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and fgf23.2

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_002940351.1 Gene:fgf23.2 / 100496800 XenbaseID:XB-GENE-482986 Length:254 Species:Xenopus tropicalis


Alignment Length:106 Identity:26/106 - (24%)
Similarity:42/106 - (39%) Gaps:18/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LDLSGNEI---QLIPDDS-FATAQLLNLQKVYLARCHLRLIE----RHAFRKLINLVELDLSQNL 171
            :|.|||..   ....||. |....|.|...||.:..|..:|.    :|.||..::|.......:|
 Frog    98 MDKSGNIFGYHDFNHDDCVFKHETLENNFDVYHSPKHNFVISLKEPKHHFRLGMDLPPYSQFLSL 162

  Fly   172 LSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVK 212
            .:.|| :..::..|         |.:|:|:..|.....::|
 Frog   163 ENEIP-ITRFNAPE---------PEMRIPEGNFADPSDIIK 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 26/106 (25%)
leucine-rich repeat 112..137 CDD:275380 8/25 (32%)
LRR_8 137..196 CDD:290566 13/62 (21%)
leucine-rich repeat 138..161 CDD:275380 7/26 (27%)
leucine-rich repeat 162..185 CDD:275380 4/22 (18%)
LRR_8 184..245 CDD:290566 6/29 (21%)
leucine-rich repeat 186..209 CDD:275380 4/22 (18%)
leucine-rich repeat 210..234 CDD:275380 1/3 (33%)
leucine-rich repeat 235..258 CDD:275380
LRRCT 267..316 CDD:214507
IG_like 328..428 CDD:214653
Ig 335..425 CDD:143165
fgf23.2XP_002940351.1 FGF 43..160 CDD:238015 17/61 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165161410
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.