DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and tlr9

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_017948709.2 Gene:tlr9 / 100494387 XenbaseID:XB-GENE-486908 Length:1035 Species:Xenopus tropicalis


Alignment Length:257 Identity:69/257 - (26%)
Similarity:107/257 - (41%) Gaps:57/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LPLHLHLLLWLLCCCSQLGQLRAEC--PAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDL 117
            |||.|.|:         ||...|.|  |....|...:...:|:|....|.|:|..:....::.||
 Frog    19 LPLSLGLI---------LGACLAFCKIPHFLPCDDFNNASTVICRERQLIHVPHIVSQSVKVFDL 74

  Fly   118 SGNEIQLIPDDSFA---TAQLLNLQ--------KVYLARCHLRLIERHAFRKLINLVELDLSQNL 171
            :.|||:|:.:.:|:   ...:|||.        :.|...|.| :||.||...|.:|..||||.|.
 Frog    75 AINEIRLLANSTFSGVPNLVILNLSDNCQPSNLRPYKEICRL-IIEPHALVSLKSLTNLDLSGNS 138

  Fly   172 LSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLEL-------SDCRLSHIAVRAF- 228
            |::||.|.    ..::.|.|:.|.|..:....|..:..:..:.|       ..|...|::..|| 
 Frog   139 LTSIPPLP----ENIKFLNLNLNQIHMISGWEFSRLNNVKMIRLGYNCFYSKQCEPFHLSDSAFI 199

  Fly   229 -------------------AGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWNC 271
                               ..|.||:..|.|..|::|::....:.:|.:||.|:|   .|||
 Frog   200 NNEFLEELALSFNNITSFPQNLPSSIRILDLSENKISKIDREDLCNLNNLHSLDL---QWNC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 50/194 (26%)
leucine-rich repeat 112..137 CDD:275380 7/27 (26%)
LRR_8 137..196 CDD:290566 23/66 (35%)
leucine-rich repeat 138..161 CDD:275380 9/30 (30%)
leucine-rich repeat 162..185 CDD:275380 10/22 (45%)
LRR_8 184..245 CDD:290566 16/87 (18%)
leucine-rich repeat 186..209 CDD:275380 5/22 (23%)
leucine-rich repeat 210..234 CDD:275380 6/50 (12%)
leucine-rich repeat 235..258 CDD:275380 5/22 (23%)
LRRCT 267..316 CDD:214507 3/5 (60%)
IG_like 328..428 CDD:214653
Ig 335..425 CDD:143165
tlr9XP_017948709.2 leucine-rich repeat 69..92 CDD:275380 7/22 (32%)
PLN00113 82..>592 CDD:215061 47/185 (25%)
leucine-rich repeat 93..128 CDD:275380 11/35 (31%)
leucine-rich repeat 129..148 CDD:275380 10/22 (45%)
leucine-rich repeat 149..172 CDD:275380 5/22 (23%)
leucine-rich repeat 173..203 CDD:275380 5/29 (17%)
leucine-rich repeat 204..224 CDD:275380 1/19 (5%)
leucine-rich repeat 225..248 CDD:275380 5/22 (23%)
leucine-rich repeat 249..289 CDD:275380 7/13 (54%)
leucine-rich repeat 290..311 CDD:275380
leucine-rich repeat 314..337 CDD:275380
leucine-rich repeat 353..394 CDD:275380
leucine-rich repeat 395..418 CDD:275380
leucine-rich repeat 482..504 CDD:275380
leucine-rich repeat 505..529 CDD:275380
leucine-rich repeat 530..553 CDD:275380
inl_like_NEAT_1 <534..>767 CDD:411101
leucine-rich repeat 554..583 CDD:275380
leucine-rich repeat 584..637 CDD:275380
leucine-rich repeat 607..629 CDD:275380
leucine-rich repeat 638..662 CDD:275380
leucine-rich repeat 663..686 CDD:275380
leucine-rich repeat 687..708 CDD:275380
leucine-rich repeat 709..732 CDD:275380
leucine-rich repeat 733..751 CDD:275380
PCC 738..>821 CDD:188093
TIR_2 875..1017 CDD:419986
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.