DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and lrrc3

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:XP_004917845.1 Gene:lrrc3 / 100492333 XenbaseID:XB-GENE-954052 Length:258 Species:Xenopus tropicalis


Alignment Length:223 Identity:57/223 - (25%)
Similarity:80/223 - (35%) Gaps:81/223 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 AECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQKV 141
            |.||..|:|....|...|.|.:.:|..||..|...|..|.|..|:|..:|:              
 Frog    30 ATCPKSCQCSDIDGATVVHCSSRDLEEIPIDLPMDTVSLKLDANKIHQVPN-------------- 80

  Fly   142 YLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSE-LRELRLSGNPILRVPDDAFG 205
                        :||:.|..|.|||||:|.:..|...|...||| |:.|.||||.|..:|.:|  
 Frog    81 ------------NAFKDLNYLQELDLSRNSIEKIDLAAFKGVSEGLKLLDLSGNQIHSIPKEA-- 131

  Fly   206 HVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWN 270
                |.||...                                             :.|:.|.|:
 Frog   132 ----LAKLRAK---------------------------------------------IRLSNNPWH 147

  Fly   271 CSCSLRP-LRAWMLQQNIPSGIPPTCES 297
            |.|||:. ||..:|..:..:.|  :|::
 Frog   148 CDCSLQEMLRELILDPDTVNEI--SCQT 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 34/157 (22%)
leucine-rich repeat 112..137 CDD:275380 6/24 (25%)
LRR_8 137..196 CDD:290566 21/59 (36%)
leucine-rich repeat 138..161 CDD:275380 3/22 (14%)
leucine-rich repeat 162..185 CDD:275380 10/22 (45%)
LRR_8 184..245 CDD:290566 14/61 (23%)
leucine-rich repeat 186..209 CDD:275380 9/22 (41%)
leucine-rich repeat 210..234 CDD:275380 3/23 (13%)
leucine-rich repeat 235..258 CDD:275380 0/22 (0%)
LRRCT 267..316 CDD:214507 11/32 (34%)
IG_like 328..428 CDD:214653
Ig 335..425 CDD:143165
lrrc3XP_004917845.1 LRRNT 32..65 CDD:214470 11/32 (34%)
leucine-rich repeat 45..67 CDD:275378 7/21 (33%)
LRR_8 67..124 CDD:338972 26/82 (32%)
leucine-rich repeat 68..88 CDD:275378 8/45 (18%)
leucine-rich repeat 89..112 CDD:275378 10/22 (45%)
leucine-rich repeat 114..137 CDD:275378 12/28 (43%)
TPKR_C2 144..>159 CDD:387596 8/14 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.