DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and si:cabz01090165.1

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_001352149.1 Gene:si:cabz01090165.1 / 100333421 ZFINID:ZDB-GENE-161017-71 Length:639 Species:Danio rerio


Alignment Length:432 Identity:109/432 - (25%)
Similarity:175/432 - (40%) Gaps:106/432 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LLLWLLCCCSQLGQLRAECPAVCECKWKSGKESVLCLNANLTHIPQPLDAGT---QLLD------ 116
            |||.:...|:........||..|.|:......:|||....|..:|..:|..|   :|:|      
Zfish     5 LLLCVCVFCASSSSSAMLCPKRCTCQNLLPSYTVLCAKTGLLFVPPNIDRQTAELRLMDNFITSL 69

  Fly   117 ---------------LSGNEIQLIPDDSFATAQ----------------------LLNLQKVYLA 144
                           ||.|.|..|...:||..|                      |:||:.:.||
Zfish    70 RHRDFANMSSLIHLTLSRNTISQIRPYAFADLQDLHALHLDANRLTVLDDTHLQGLVNLRHLILA 134

  Fly   145 RCHLRLIERHAFRKLINLVE-LDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVP 208
            ...:..|...||:..:..:| ||||.|.|..:|...:..::.:..|.|..|.|..||:..|.::.
Zfish   135 NNQIHSISEGAFQDFLETLEDLDLSYNNLVDLPWDTIAMLASVNTLSLDHNLIEFVPEGIFSNLH 199

  Fly   209 QLVKLELSDCRLSHI-------AVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELAR 266
            :|.:|:::..:|..|       .:..:|.::.|                 .:|:|.    |....
Zfish   200 KLARLDMTSNKLKKIPPDPLFLRIPVYAKMKGS-----------------PLTALV----LSFGG 243

  Fly   267 NTWNCSCSLRPLRAWMLQQNIPSGIPPTCESPPRLSGRAWDKLDVDDFACVPQIVATDTTAHGV- 330
            |..:|:|.|..||....:.::     .||.||..|:|:.:..:..::|.|.|.::...|:...| 
Zfish   244 NPLHCNCELVWLRRLTREDDL-----ETCASPRELAGKYFWTIREEEFVCEPPMITRHTSKMFVM 303

  Fly   331 EGRNITMSCYVEGVPQPAVKWLLKN-RLIANLSAGGDGDSDSEPRTAAATQGRKTYVVNMLRNAS 394
            ||:.:::.|...|.|:|.|.|:..: :||||.|           ||.....|             
Zfish   304 EGQEVSLRCRSVGDPEPIVHWISPDGKLIANTS-----------RTVCYDNG------------- 344

  Fly   395 NLTILTADMQDAGIYTCAAENKAGKVEASVTLAVSRRPPEAP 436
            :|.||||.::|:|::||.|.|.||:..|.|.|.|:..|...|
Zfish   345 SLDILTATVKDSGVFTCIASNAAGEATAPVELVVNPSPHYDP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 43/210 (20%)
leucine-rich repeat 112..137 CDD:275380 12/70 (17%)
LRR_8 137..196 CDD:290566 18/59 (31%)
leucine-rich repeat 138..161 CDD:275380 6/22 (27%)
leucine-rich repeat 162..185 CDD:275380 8/23 (35%)
LRR_8 184..245 CDD:290566 13/67 (19%)
leucine-rich repeat 186..209 CDD:275380 7/22 (32%)
leucine-rich repeat 210..234 CDD:275380 5/30 (17%)
leucine-rich repeat 235..258 CDD:275380 2/22 (9%)
LRRCT 267..316 CDD:214507 13/48 (27%)
IG_like 328..428 CDD:214653 33/101 (33%)
Ig 335..425 CDD:143165 28/90 (31%)
si:cabz01090165.1NP_001352149.1 LRR <31..>216 CDD:227223 44/184 (24%)
leucine-rich repeat 58..79 CDD:275380 2/20 (10%)
leucine-rich repeat 80..103 CDD:275380 7/22 (32%)
leucine-rich repeat 104..127 CDD:275380 1/22 (5%)
leucine-rich repeat 128..152 CDD:275380 6/23 (26%)
leucine-rich repeat 153..176 CDD:275380 8/22 (36%)
leucine-rich repeat 177..200 CDD:275380 7/22 (32%)
leucine-rich repeat 201..219 CDD:275380 4/17 (24%)
TPKR_C2 244..>276 CDD:326558 11/36 (31%)
Ig 305..378 CDD:325142 31/96 (32%)
fn3 416..491 CDD:306538
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6336
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6373
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.