DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kek3 and slitrk1

DIOPT Version :9

Sequence 1:NP_001162986.1 Gene:kek3 / 34912 FlyBaseID:FBgn0028370 Length:1021 Species:Drosophila melanogaster
Sequence 2:NP_001096395.1 Gene:slitrk1 / 100124997 XenbaseID:XB-GENE-998737 Length:696 Species:Xenopus tropicalis


Alignment Length:474 Identity:103/474 - (21%)
Similarity:159/474 - (33%) Gaps:172/474 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LLLWL----------------------LCCCSQL-GQLRAECPAVCECKWKSGKESVLCLNANLT 102
            :|||:                      ||.|::: |.|..:|          ||:..    :||.
 Frog     1 MLLWILLLEISLCFASGNVTRDVCKEKLCSCNEVEGDLHVDC----------GKKGF----SNLQ 51

  Fly   103 HIPQPLDAGTQLLDLSGNEI-QLIPDD--SFATAQLLNLQ-------------------KVYLAR 145
            |...|......|. |.||.: :|.|::  :|..|..|:::                   ::::..
 Frog    52 HFSAPTSQFYHLF-LHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKRLHINN 115

  Fly   146 CHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQL 210
            ..::...||.|..|.:|..|....|||..|...|...:::|..|.|:.|.|..:|.:.|.:||  
 Frog   116 NKIKSFRRHTFLGLDDLEYLQADFNLLRDIDPGAFRDLNKLEVLILNDNLISTLPTNVFQYVP-- 178

  Fly   211 VKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEV-RSGTITSLASLHGLELARNTWNCSCS 274
                     ::|:.:|               |||:..: ..|.:..:..:..:.|..|.|:|||.
 Frog   179 ---------ITHLDLR---------------GNRVKTLPYEGVLEQIPGIAEILLEDNPWDCSCD 219

  Fly   275 LRPLRAWMLQQNIPSGI---PPTCESPPRLSGRAWD----------KLDVDDFACVPQI------ 320
            |..|:.|:  :|||...   ...||:|.||.|...:          |..||.....|..      
 Frog   220 LLSLKEWL--ENIPKNALIGRVVCEAPTRLQGNDLNETTEQELCPLKNAVDSSLAAPPAQDETYD 282

  Fly   321 ---VATDTTAHGVEGRNITMSCYVEGVPQPAVKWLLKNRLIANL-------------------SA 363
               :.|.....|.| .:.|......|..:....|.:|.|..|.:                   |.
 Frog   283 PGPIPTPFKISGQE-ESATPGSSASGGTKIPGNWQIKTRPTAVMSEIHSHLKPPHAFACPAVCSC 346

  Fly   364 G----GDG--------------DSDSEP--------RTAAATQGRKTYVVNMLRNASNLTILTAD 402
            |    |.|              |.|.:|        |.......|||:.|:.:    |||:|   
 Frog   347 GQQILGPGLKVDCSNKNVKSLADLDPKPPNVQELFLRENKIHTIRKTHFVDYV----NLTLL--- 404

  Fly   403 MQDAGIYTCAAENKAGKVE 421
              |.|      .|..|.||
 Frog   405 --DLG------NNNIGMVE 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kek3NP_001162986.1 LRR_RI <110..267 CDD:238064 36/179 (20%)
leucine-rich repeat 112..137 CDD:275380 8/27 (30%)
LRR_8 137..196 CDD:290566 15/77 (19%)
leucine-rich repeat 138..161 CDD:275380 4/41 (10%)
leucine-rich repeat 162..185 CDD:275380 7/22 (32%)
LRR_8 184..245 CDD:290566 13/60 (22%)
leucine-rich repeat 186..209 CDD:275380 8/22 (36%)
leucine-rich repeat 210..234 CDD:275380 2/23 (9%)
leucine-rich repeat 235..258 CDD:275380 4/23 (17%)
LRRCT 267..316 CDD:214507 20/61 (33%)
IG_like 328..428 CDD:214653 30/139 (22%)
Ig 335..425 CDD:143165 28/132 (21%)
slitrk1NP_001096395.1 leucine-rich repeat 62..83 CDD:275380 7/21 (33%)
leucine-rich repeat 84..107 CDD:275380 2/22 (9%)
LRR_8 108..166 CDD:338972 15/57 (26%)
leucine-rich repeat 108..131 CDD:275380 4/22 (18%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
leucine-rich repeat 156..177 CDD:275380 7/20 (35%)
TPKR_C2 212..>249 CDD:387596 16/38 (42%)
leucine-rich repeat 238..355 CDD:275380 22/117 (19%)
leucine-rich repeat 356..376 CDD:275380 3/19 (16%)
LRR_8 <375..411 CDD:338972 12/50 (24%)
leucine-rich repeat 377..400 CDD:275380 5/26 (19%)
LRR_8 400..457 CDD:338972 10/27 (37%)
leucine-rich repeat 401..424 CDD:275380 9/26 (35%)
leucine-rich repeat 425..448 CDD:275380
LRR_8 448..506 CDD:338972
leucine-rich repeat 449..472 CDD:275380
leucine-rich repeat 473..495 CDD:275380
leucine-rich repeat 496..520 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.