DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lace and SPTLC1

DIOPT Version :9

Sequence 1:NP_001285957.1 Gene:lace / 34910 FlyBaseID:FBgn0002524 Length:597 Species:Drosophila melanogaster
Sequence 2:NP_001268232.1 Gene:SPTLC1 / 10558 HGNCID:11277 Length:513 Species:Homo sapiens


Alignment Length:271 Identity:87/271 - (32%)
Similarity:145/271 - (53%) Gaps:20/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 CLNLGSYNYLGF-------AAATGQCADDSEESARSSGLAYCSSRCELGDNEQLQELEALTARYF 272
            |:|..|:|:||.       |||..        |.:..|:..|..|...|..:...:||...|::.
Human   100 CINFASFNFLGLLDNPRVKAAALA--------SLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFM 156

  Fly   273 GVEDAIVFGMGFATNALNLPSLLGPNSLVISDEKNHASIILGLRLSGATTKVFKHNNMRDLERVL 337
            ..|:||::..||||.|..:|:......:|..|.....:|..||:.|.:..|:||||:|.||||:|
Human   157 KTEEAIIYSYGFATIASAIPAYSKRGDIVFVDRAACFAIQKGLQASRSDIKLFKHNDMADLERLL 221

  Fly   338 RQGVC--YGNPKKGGQPWDKVMILVEGIFSMEGSIVRLPEVIALKKKYKAYLYLDEAHSVGAMGS 400
            ::...  ..||:|...  .:..|:|||::...|:|..|||::.||.||||.::|:|:.|.|.:|.
Human   222 KEQEIEDQKNPRKARV--TRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGE 284

  Fly   401 RGRGVTDYFNVDPKEVDILMGTFTKSFGSAGGYLAGSKKLIDFLRTNSHAHCYAASISPPIAQQI 465
            .|||||:::.::..::|::......:..|.||:..|...:||..|.:...:|::||:.|.:|...
Human   285 HGRGVTEHYGINIDDIDLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAA 349

  Fly   466 LTSMKTIMGED 476
            :.:: .||.|:
Human   350 IEAL-NIMEEN 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
laceNP_001285957.1 PLN02483 117..587 CDD:178101 87/271 (32%)
BioF 164..577 CDD:223234 87/271 (32%)
SPTLC1NP_001268232.1 AAT_I 11..442 CDD:418510 87/271 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0156
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D312139at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.