DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment sna and USV1

DIOPT Version :9

Sequence 1:	NP_476732.1	Gene:	sna / 34908	FlyBaseID:	FBgn0003448	Length:	390	Species:	Drosophila melanogaster
Sequence 2:	NP_015094.1	Gene:	USV1 / 855871	SGDID:	S000006151	Length:	391	Species:	Saccharomyces cerevisiae

Alignment Length:	74	Identity:	28/74 - (37%)
Similarity:	41/74 - (55%)	Gaps:	0/74 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   311 CGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFADRSNLRAHQQTHVDVKKYACQVCHKSFSRMS 375
            |..:|:|...|..|||.||||||||||.|.:.|:...||:.|:::....|.:.....|:.....|
Yeast    49 CTMSFTRAEHLARHIRKHTGEKPFQCPACLKFFSRVDNLKQHRESVHAHKNHHSTSSHQRKPSSS 113

  Fly   376 LLNKHSSSN 384
            .|:..||::
Yeast   114 SLSSSSSAS 122

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
sna	NP_476732.1	C2H2 Zn finger	308..328	CDD:275368	7/16 (44%)
		zf-H2C2_2	321..344	CDD:290200	15/22 (68%)
		zf-C2H2	334..356	CDD:278523	9/21 (43%)
		C2H2 Zn finger	336..356	CDD:275368	7/19 (37%)
		zf-H2C2_2	348..373	CDD:290200	5/24 (21%)
		C2H2 Zn finger	364..380	CDD:275368	3/15 (20%)
		C2H2 Zn finger	247..267	CDD:275368
		C2H2 Zn finger	282..302	CDD:275368
		zf-C2H2	306..328	CDD:278523	7/16 (44%)
		COG5048	307..>356	CDD:227381	22/44 (50%)
USV1	NP_015094.1	COG5048	11..389	CDD:227381	28/74 (38%)
		C2H2 Zn finger	43..66	CDD:275368	7/16 (44%)
		C2H2 Zn finger	74..91	CDD:275368	6/16 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S4280
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.950