DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sna and snai1b

DIOPT Version :9

Sequence 1:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_571064.2 Gene:snai1b / 792194 ZFINID:ZDB-GENE-980526-514 Length:256 Species:Danio rerio


Alignment Length:258 Identity:104/258 - (40%)
Similarity:132/258 - (51%) Gaps:60/258 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 PISALWSSYQPHLAAFPSPASSMASPQSVYSYQQMTPPSSPGSDLETGSEPEDLSVRNDIPLPAL 200
            |...:|||   ....||..:||::.|.:....      |||.|...:|.|               
Zfish    47 PSMLVWSS---SALPFPGVSSSVSCPPAPLDL------SSPSSSSSSGEE--------------- 87

  Fly   201 FHLFDEAKSSSSGASVSSSSGYSYTPAMSASSASVAANHAKNYRFKCDECQKMYSTSMGLSKHRQ 265
                |:.::|.             .|:...|.           ||:|..|.|..|:...||:|:.
Zfish    88 ----DDCRTSD-------------PPSPDPSD-----------RFQCAHCGKSCSSPAALSRHQL 124

  Fly   266 FHC--------PAAECNQEKKTHSCEECGKLYTTIGALKMHIRTHTLPCKCPICGKAFSRPWLLQ 322
            .||        ..:.....:....|:.|.|.|.::||||||||:|||||.|..|||||||||||:
Zfish   125 AHCSPQDGISGATSSLTSSRAAFHCKHCPKEYNSLGALKMHIRSHTLPCVCSTCGKAFSRPWLLR 189

  Fly   323 GHIRTHTGEKPFQCPDCPRSFADRSNLRAHQQTHVDVKKYACQVCHKSFSRMSLLNKHSSSNC 385
            |||||||||:||.||.|.|:||||||||||.|||.:||||.|..|.::|||||||:||:.|.|
Zfish   190 GHIRTHTGERPFSCPHCNRAFADRSNLRAHLQTHSEVKKYQCGSCSRTFSRMSLLHKHTLSGC 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 16/19 (84%)
zf-H2C2_2 321..344 CDD:290200 16/22 (73%)
zf-C2H2 334..356 CDD:278523 16/21 (76%)
C2H2 Zn finger 336..356 CDD:275368 15/19 (79%)
zf-H2C2_2 348..373 CDD:290200 15/24 (63%)
C2H2 Zn finger 364..380 CDD:275368 9/15 (60%)
C2H2 Zn finger 247..267 CDD:275368 7/19 (37%)
C2H2 Zn finger 282..302 CDD:275368 12/19 (63%)
zf-C2H2 306..328 CDD:278523 17/21 (81%)
COG5048 307..>356 CDD:227381 38/48 (79%)
snai1bNP_571064.2 C2H2 Zn finger 149..169 CDD:275368 12/19 (63%)
C2H2 Zn finger 175..195 CDD:275368 16/19 (84%)
zf-H2C2_2 188..211 CDD:316026 16/22 (73%)
zf-C2H2 201..223 CDD:306579 16/21 (76%)
C2H2 Zn finger 203..223 CDD:275368 15/19 (79%)
C2H2 Zn finger 231..247 CDD:275368 9/15 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11673
eggNOG 1 0.900 - - E1_KOG2462
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 221 1.000 Inparanoid score I3523
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004977
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.