DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sna and wdn

DIOPT Version :9

Sequence 1:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_476900.1 Gene:wdn / 43398 FlyBaseID:FBgn0005642 Length:869 Species:Drosophila melanogaster


Alignment Length:447 Identity:101/447 - (22%)
Similarity:171/447 - (38%) Gaps:115/447 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RLPQTEALALTKDSQFAQDQP-----QDLSLKRGRDEETQDYQQ---PEPKRDYVLNLSKTPERN 77
            |:...::::..||.....|..     ...||..|....:.|:.:   ...:.:..||||....|:
  Fly    46 RINNFDSISSIKDESLDIDLSACVTISSASLVNGNSLSSTDFWRVLDESAQNNTELNLSSDVCRD 110

  Fly    78 SSSSSNSCLLSPPVEAQDYLPTEIHMRGLT------------AGTTGYTTATPTTINPFQSAFVM 130
            ..::::|..:...:.:.::..:|..:..|.            ..|:...|:||..::|.|     
  Fly   111 DLAATSSSTVPSTLTSDNHSSSEFSVTFLRPEPPNAFTNSPFKKTSSSGTSTPVKLSPEQ----- 170

  Fly   131 AAGCNPISALWSSYQPHLAAFPSPASSMASPQSVYSYQQMTPPSSPGSDLETGSE--------PE 187
                        .:|.|         .:..|||....::...|::....|:...|        ||
  Fly   171 ------------LHQQH---------QLQMPQSQLLQRKPKLPAATAVRLKVFKEEPPEEKHPPE 214

  Fly   188 DLSVRNDI----PLPALFHLFDEAKSSSSGASVSS--SSGYSYTPAMSASSASV----------- 235
            .:..:.::    .||..|.:|.:|||:.|.|..:|  ....|.|..:....|.:           
  Fly   215 QVVTKVEVCESELLPPSFTIFQQAKSAESVADAASMPPPAASETKPLEVDPAPLHKCLDCNGLLL 279

  Fly   236 ----------AANHAKNYRFKCDECQKMYSTSMGLSKHRQFHCPAAECNQEKKTHSCEECGKLYT 290
                      ||.|.....::|.|||:.:....||.||.:.|......:..||   |.:|||. .
  Fly   280 ETPDEVAKHEAAAHRLRLTYRCSECQREFELLAGLKKHLKTHRTEGRKDTWKK---CPDCGKC-L 340

  Fly   291 TIGALKMHIRTHT--LPCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFADRSNLRAHQ 353
            .:|::.||.:.|:  ...:|.|||:.|.:...|..|.|.|:.|||::||:|.:.|.:||:|:.||
  Fly   341 KLGSMWMHRKIHSDNKKYQCDICGQKFVQKINLTHHARIHSSEKPYECPECQKRFQERSHLQRHQ 405

  Fly   354 QTHVDVKKY----------------------------ACQVCHKSFSRMSLLNKHSS 382
            :.|...:.|                            ||.||.|||...|.|.:||:
  Fly   406 KYHAQTRSYRCEKCGKMYKTERCLKVHNLVHLEQRPFACTVCDKSFISNSKLKQHSN 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 8/19 (42%)
zf-H2C2_2 321..344 CDD:290200 10/22 (45%)
zf-C2H2 334..356 CDD:278523 9/21 (43%)
C2H2 Zn finger 336..356 CDD:275368 9/19 (47%)
zf-H2C2_2 348..373 CDD:290200 12/52 (23%)
C2H2 Zn finger 364..380 CDD:275368 8/15 (53%)
C2H2 Zn finger 247..267 CDD:275368 8/19 (42%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
zf-C2H2 306..328 CDD:278523 8/21 (38%)
COG5048 307..>356 CDD:227381 21/48 (44%)
wdnNP_476900.1 C2H2 Zn finger 301..321 CDD:275368 8/19 (42%)
RPB9 333..425 CDD:224510 31/92 (34%)
C2H2 Zn finger 333..352 CDD:275368 7/19 (37%)
zf-H2C2_2 344..369 CDD:290200 8/24 (33%)
zf-C2H2 358..380 CDD:278523 8/21 (38%)
C2H2 Zn finger 360..380 CDD:275368 8/19 (42%)
zf-H2C2_2 372..395 CDD:290200 10/22 (45%)
zf-C2H2 386..408 CDD:278523 9/21 (43%)
C2H2 Zn finger 388..436 CDD:275368 11/47 (23%)
zf-H2C2_2 400..425 CDD:290200 5/24 (21%)
C2H2 Zn finger 416..433 CDD:275368 0/16 (0%)
zf-H2C2_2 429..453 CDD:290200 7/23 (30%)
C2H2 Zn finger 444..464 CDD:275368 10/19 (53%)
zf-H2C2_2 457..481 CDD:290200 3/6 (50%)
C2H2 Zn finger 472..493 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457202
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.