DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment sna and CG7691

DIOPT Version :9

Sequence 1:	NP_476732.1	Gene:	sna / 34908	FlyBaseID:	FBgn0003448	Length:	390	Species:	Drosophila melanogaster
Sequence 2:	NP_650728.1	Gene:	CG7691 / 42228	FlyBaseID:	FBgn0038626	Length:	283	Species:	Drosophila melanogaster

Alignment Length:	83	Identity:	42/83 - (50%)
Similarity:	54/83 - (65%)	Gaps:	5/83 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   307 KCPICGKAFSRPWLLQGHIRTHTGEKPFQCPD--CPRSFADRSNLRAHQQT--HVDVKKYACQVC 367
            :|..|.|.|...|:|..|.|||||||||.|||  |.::|:||||||:||:|  |.: .::.|..|
  Fly   190 ECIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGHHE-WQHQCGQC 253

  Fly   368 HKSFSRMSLLNKHSSSNC 385
            .|.||:.|.||:||...|
  Fly   254 GKYFSQFSYLNRHSLDAC 271

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
sna	NP_476732.1	C2H2 Zn finger	308..328	CDD:275368	8/19 (42%)
		zf-H2C2_2	321..344	CDD:290200	15/24 (63%)
		zf-C2H2	334..356	CDD:278523	15/25 (60%)
		C2H2 Zn finger	336..356	CDD:275368	14/23 (61%)
		zf-H2C2_2	348..373	CDD:290200	11/26 (42%)
		C2H2 Zn finger	364..380	CDD:275368	8/15 (53%)
		C2H2 Zn finger	247..267	CDD:275368
		C2H2 Zn finger	282..302	CDD:275368
		zf-C2H2	306..328	CDD:278523	8/20 (40%)
		COG5048	307..>356	CDD:227381	30/52 (58%)
CG7691	NP_650728.1	COG5048	188..>271	CDD:227381	41/81 (51%)
		C2H2 Zn finger	191..211	CDD:275368	8/19 (42%)
		zf-H2C2_2	203..229	CDD:290200	15/25 (60%)
		C2H2 Zn finger	219..244	CDD:275368	14/24 (58%)
		C2H2 Zn finger	250..266	CDD:275368	8/15 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2462
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900