DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sna and CG6813

DIOPT Version :9

Sequence 1:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster


Alignment Length:173 Identity:51/173 - (29%)
Similarity:72/173 - (41%) Gaps:26/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 PAMSASSASVAANHAKNY-----RFKCDECQKMYSTSMGLSKH-------RQFHCPAAECNQEKK 278
            |:....||..:.||.|:.     .:.|.:|.::.:......:|       :.|||....|.:.  
  Fly   118 PSAEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERS-- 180

  Fly   279 THSCEECGKLYTTIGALKMHIRTHT--LPCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPR 341
                      :.|...|..|.|.||  .|..|..|.:.||.....|.|.|.|..|:.::|..|.:
  Fly   181 ----------FATRKELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKK 235

  Fly   342 SFADRSNLRAHQQTHVDVKKYACQVCHKSFSRMSLLNKHSSSN 384
            ||.....||.|:..|||.:.:.|.||.|.|.|:|.|..|.|||
  Fly   236 SFVSSGCLRKHKMIHVDARNHYCYVCQKHFKRISHLMTHLSSN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 7/19 (37%)
zf-H2C2_2 321..344 CDD:290200 8/22 (36%)
zf-C2H2 334..356 CDD:278523 7/21 (33%)
C2H2 Zn finger 336..356 CDD:275368 7/19 (37%)
zf-H2C2_2 348..373 CDD:290200 11/24 (46%)
C2H2 Zn finger 364..380 CDD:275368 8/15 (53%)
C2H2 Zn finger 247..267 CDD:275368 3/26 (12%)
C2H2 Zn finger 282..302 CDD:275368 4/19 (21%)
zf-C2H2 306..328 CDD:278523 7/21 (33%)
COG5048 307..>356 CDD:227381 16/48 (33%)
CG6813NP_001163590.1 zf-AD 6..76 CDD:285071
C2H2 Zn finger 144..164 CDD:275368 3/19 (16%)
C2H2 Zn finger 172..194 CDD:275368 6/33 (18%)
zf-H2C2_2 186..211 CDD:290200 9/24 (38%)
UFD2 <256..>294 CDD:227443 12/23 (52%)
C2H2 Zn finger 258..280 CDD:275368 12/21 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468410
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.