DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sna and CG4820

DIOPT Version :9

Sequence 1:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001097748.1 Gene:CG4820 / 41344 FlyBaseID:FBgn0037876 Length:362 Species:Drosophila melanogaster


Alignment Length:229 Identity:54/229 - (23%)
Similarity:80/229 - (34%) Gaps:61/229 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 PQSVYSYQQMTPP----SSPGSDLETGSEPEDLSVRNDIPLPALFHLFDEAKSSSSGASVSSSSG 221
            ||:.|...|:...    ::||.|:              :|||.     |..::.:..|:.::.  
  Fly   129 PQAPYPENQLEQALSYGNAPGEDI--------------LPLPE-----DYGEAQTEVATTTNE-- 172

  Fly   222 YSYTPAMSASSASVAANHAKNYRFKCDECQKMYSTSMGLSKHRQFHCPAAECNQEKKTHSCEECG 286
                ||...|.     |.||   .|    .|.::..:|   .:..|....:..|.|:.  .:..|
  Fly   173 ----PAQRRSK-----NTAK---IK----SKKHTMRVG---RKLIHVKVIDDKQPKRI--VDRNG 216

  Fly   287 KLYTTIGALKMHIRTHTLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFADRSNLRA 351
                          ....||.|..||:.|.....|..|:..|||.|||:|..|.:.......||.
  Fly   217 --------------PSAKPCICEHCGRQFKDTSNLHVHLLRHTGTKPFECDQCHQKCYTLHLLRR 267

  Fly   352 HQQTHVDVKKYACQVCHKSFSRMSLLNKHSSSNC 385
            ||..|.: ..|||..|...:|..|...:|....|
  Fly   268 HQLKHTE-GPYACTFCGLEYSTNSSRVRHEREAC 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 6/19 (32%)
zf-H2C2_2 321..344 CDD:290200 10/22 (45%)
zf-C2H2 334..356 CDD:278523 7/21 (33%)
C2H2 Zn finger 336..356 CDD:275368 6/19 (32%)
zf-H2C2_2 348..373 CDD:290200 9/24 (38%)
C2H2 Zn finger 364..380 CDD:275368 4/15 (27%)
C2H2 Zn finger 247..267 CDD:275368 2/19 (11%)
C2H2 Zn finger 282..302 CDD:275368 1/19 (5%)
zf-C2H2 306..328 CDD:278523 7/21 (33%)
COG5048 307..>356 CDD:227381 18/48 (38%)
CG4820NP_001097748.1 zf-AD 4..75 CDD:285071
C2H2 Zn finger 224..244 CDD:275368 6/19 (32%)
C2H2 Zn finger 252..272 CDD:275368 6/19 (32%)
C2H2 Zn finger 279..297 CDD:275368 5/17 (29%)
C2H2 Zn finger 322..339 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457232
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.