| Sequence 1: | NP_476732.1 | Gene: | sna / 34908 | FlyBaseID: | FBgn0003448 | Length: | 390 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097560.1 | Gene: | MTF-1 / 39089 | FlyBaseID: | FBgn0040305 | Length: | 1006 | Species: | Drosophila melanogaster |
| Alignment Length: | 501 | Identity: | 119/501 - (23%) |
|---|---|---|---|
| Similarity: | 173/501 - (34%) | Gaps: | 198/501 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 51 DEETQDYQQPE-------------------PKRDYVLNLSKT------PERNSSSSSNSC----- 85
Fly 86 ---LLSPPVEA--------QDYL------------PTEIHMRGLTA-------------GTTGYT 114
Fly 115 TATPTTINPFQSAFVMAAGCN-----------PISALWSSYQ---PHLAAFPSPASSMASPQSV- 164
Fly 165 --------------YSYQ-----QMTPP--------SSPG----------SDLETG--------- 183
Fly 184 ------------------SEP-EDLSVRNDIPLPALFHL------------FDEAKSSSSGASVS 217
Fly 218 SSSGYSYTPAMSASSASVAAN-------HAKNYRFKC--DECQKMYSTSMGLSKHRQFH------ 267
Fly 268 -CPAAECNQ---------------EKKTHSCEECGKLYTTIGALKMHIRTHT--LPCKCP--ICG 312
Fly 313 KAFSRPWLLQGHIRTHTGEKPFQCPD--CPRSFADRSNLRAHQQTH 356 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sna | NP_476732.1 | C2H2 Zn finger | 308..328 | CDD:275368 | 10/21 (48%) |
| zf-H2C2_2 | 321..344 | CDD:290200 | 13/24 (54%) | ||
| zf-C2H2 | 334..356 | CDD:278523 | 6/23 (26%) | ||
| C2H2 Zn finger | 336..356 | CDD:275368 | 6/21 (29%) | ||
| zf-H2C2_2 | 348..373 | CDD:290200 | 4/9 (44%) | ||
| C2H2 Zn finger | 364..380 | CDD:275368 | |||
| C2H2 Zn finger | 247..267 | CDD:275368 | 8/21 (38%) | ||
| C2H2 Zn finger | 282..302 | CDD:275368 | 10/19 (53%) | ||
| zf-C2H2 | 306..328 | CDD:278523 | 11/23 (48%) | ||
| COG5048 | 307..>356 | CDD:227381 | 24/52 (46%) | ||
| MTF-1 | NP_001097560.1 | zf-C2H2_aberr | 329..471 | CDD:293622 | 46/141 (33%) |
| C2H2 Zn finger | 331..353 | CDD:275368 | 3/21 (14%) | ||
| zf-H2C2_2 | 345..372 | CDD:290200 | 9/26 (35%) | ||
| C2H2 Zn finger | 361..383 | CDD:275368 | 8/21 (38%) | ||
| zf-H2C2_2 | 375..402 | CDD:290200 | 5/26 (19%) | ||
| C2H2 Zn finger | 391..413 | CDD:275368 | 2/21 (10%) | ||
| zf-C2H2 | 418..440 | CDD:278523 | 10/21 (48%) | ||
| C2H2 Zn finger | 420..440 | CDD:275368 | 10/19 (53%) | ||
| zf-H2C2_2 | 432..458 | CDD:290200 | 15/25 (60%) | ||
| COG5048 | 442..>519 | CDD:227381 | 27/59 (46%) | ||
| C2H2 Zn finger | 448..470 | CDD:275368 | 10/21 (48%) | ||
| zf-H2C2_2 | 462..489 | CDD:290200 | 14/26 (54%) | ||
| C2H2 Zn finger | 478..500 | CDD:275368 | 6/21 (29%) | ||
| DUF3682 | 862..>931 | CDD:289231 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45457149 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||