DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sna and D19B

DIOPT Version :9

Sequence 1:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster


Alignment Length:179 Identity:55/179 - (30%)
Similarity:76/179 - (42%) Gaps:39/179 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 HAKNYR----FKC--DECQKMYSTSMGLSKHRQ--------FH-CPAAECNQE-----------K 277
            |.|::.    |:|  :.|:|.::|:.||..|.:        .| |....||:.           |
  Fly   271 HMKHHNDLLPFQCTVESCRKGFTTANGLRVHVEHAHTETSAMHPCTYEGCNKSFARPVLLSFHMK 335

  Fly   278 KTHS---------CEECGKLYTTIGALKMHIRTHT---LPCKCPICGKAFSRPWLLQGHIRTHTG 330
            :.|.         |.||.|::....|||.|:..||   ||..|.||||.|....:|:.|:..|.|
  Fly   336 RVHKVDTPQRDFPCTECEKVFRCPTALKKHMYKHTGEELPFACEICGKRFPINSVLRDHLLRHAG 400

  Fly   331 EKPFQCPDCPRSFADRSNLRAHQQTHVDVKKYACQVC-HKSFSRMSLLN 378
            .|...||.|......|.....|..||...|||.|:.| |.|.::.:|.|
  Fly   401 IKNHVCPYCGVGKTTRQEWNKHILTHTKEKKYECRQCDHASHNKQALAN 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 8/19 (42%)
zf-H2C2_2 321..344 CDD:290200 8/22 (36%)
zf-C2H2 334..356 CDD:278523 5/21 (24%)
C2H2 Zn finger 336..356 CDD:275368 5/19 (26%)
zf-H2C2_2 348..373 CDD:290200 10/25 (40%)
C2H2 Zn finger 364..380 CDD:275368 6/16 (38%)
C2H2 Zn finger 247..267 CDD:275368 7/29 (24%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-C2H2 306..328 CDD:278523 8/21 (38%)
COG5048 307..>356 CDD:227381 16/48 (33%)
D19BNP_477297.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 255..275 CDD:275368 2/3 (67%)
C2H2 Zn finger 283..335 CDD:275368 11/51 (22%)
C2H2 Zn finger 318..338 CDD:275368 3/19 (16%)
COG5048 <347..512 CDD:227381 39/103 (38%)
C2H2 Zn finger 349..369 CDD:275368 8/19 (42%)
C2H2 Zn finger 378..398 CDD:275368 8/19 (42%)
C2H2 Zn finger 406..426 CDD:275368 5/19 (26%)
C2H2 Zn finger 434..455 CDD:275368 6/16 (38%)
C2H2 Zn finger 463..483 CDD:275368
C2H2 Zn finger 491..511 CDD:275368
C2H2 Zn finger 586..607 CDD:275368
C2H2 Zn finger 615..635 CDD:275368
zf-H2C2_2 627..652 CDD:290200
C2H2 Zn finger 643..663 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.