DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sna and CG10274

DIOPT Version :9

Sequence 1:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001097525.1 Gene:CG10274 / 38716 FlyBaseID:FBgn0035690 Length:863 Species:Drosophila melanogaster


Alignment Length:300 Identity:77/300 - (25%)
Similarity:100/300 - (33%) Gaps:92/300 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 SSMASPQSVYSYQQMTPPSSPGSD-----------------------------LETGSEPED--- 188
            ||..|.:.:.......|.||.|.|                             ..||||.||   
  Fly   184 SSEESEEDIDQDVDFEPNSSDGDDDVPLAQRLRDNSRMIPKAKAAVIKEEDQEFPTGSEEEDEDG 248

  Fly   189 ---LSVRNDIPLPALFHLFDEAKSSSSGASVSSSSGYSYTPAMSASSASVAANHAKNYR----FK 246
               .|.|..|| |...||...............:..|.              .|.|::.    |:
  Fly   249 EKSKSRRKRIP-PGERHLHRIIDCHICHQKFKKAIRYE--------------EHMKHHNDLLPFQ 298

  Fly   247 C--DECQKMYSTSMGLSKH-RQFHCPAAE---CNQE----------------KKTHS-------- 281
            |  :.|:|.::|:.||..| ...|...:|   ||.:                ||.|.        
  Fly   299 CKVETCRKGFTTAGGLRLHIDHAHTELSEVHSCNVDGCGKTFPRIRLLTFHMKKMHGITKAAAPP 363

  Fly   282 ----CEECGKLYTTIGALKMHIRTH---TLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPDC 339
                |.||.|::....|||.|:..|   .||..|.||||.|.....|:.|:..|.|.|.:.||.|
  Fly   364 RDYPCTECEKVFRCPMALKKHMYKHDGKELPFPCNICGKRFVINSALKDHLMRHAGIKNYVCPYC 428

  Fly   340 PRSFADRSNLRAHQQTHVDVKKYACQVC-HKSFSRMSLLN 378
            ......|.....|..||...||:.|.:| |.|.::.||.|
  Fly   429 GVGKTTRQEWNTHILTHTQEKKFKCHICEHASHNKQSLAN 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 8/19 (42%)
zf-H2C2_2 321..344 CDD:290200 8/22 (36%)
zf-C2H2 334..356 CDD:278523 5/21 (24%)
C2H2 Zn finger 336..356 CDD:275368 5/19 (26%)
zf-H2C2_2 348..373 CDD:290200 9/25 (36%)
C2H2 Zn finger 364..380 CDD:275368 6/15 (40%)
C2H2 Zn finger 247..267 CDD:275368 7/22 (32%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-C2H2 306..328 CDD:278523 8/21 (38%)
COG5048 307..>356 CDD:227381 16/48 (33%)
CG10274NP_001097525.1 zf-AD 15..90 CDD:214871
C2H2 Zn finger 334..353 CDD:275368 1/18 (6%)
C2H2 Zn finger 368..388 CDD:275368 8/19 (42%)
COG5048 394..729 CDD:227381 27/74 (36%)
C2H2 Zn finger 397..417 CDD:275368 8/19 (42%)
C2H2 Zn finger 425..445 CDD:275368 5/19 (26%)
C2H2 Zn finger 453..474 CDD:275368 6/15 (40%)
C2H2 Zn finger 482..502 CDD:275368
C2H2 Zn finger 510..530 CDD:275368
C2H2 Zn finger 638..659 CDD:275368
C2H2 Zn finger 667..687 CDD:275368
zf-H2C2_2 680..704 CDD:290200
C2H2 Zn finger 695..715 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.