Sequence 1: | NP_476732.1 | Gene: | sna / 34908 | FlyBaseID: | FBgn0003448 | Length: | 390 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097525.1 | Gene: | CG10274 / 38716 | FlyBaseID: | FBgn0035690 | Length: | 863 | Species: | Drosophila melanogaster |
Alignment Length: | 300 | Identity: | 77/300 - (25%) |
---|---|---|---|
Similarity: | 100/300 - (33%) | Gaps: | 92/300 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 156 SSMASPQSVYSYQQMTPPSSPGSD-----------------------------LETGSEPED--- 188
Fly 189 ---LSVRNDIPLPALFHLFDEAKSSSSGASVSSSSGYSYTPAMSASSASVAANHAKNYR----FK 246
Fly 247 C--DECQKMYSTSMGLSKH-RQFHCPAAE---CNQE----------------KKTHS-------- 281
Fly 282 ----CEECGKLYTTIGALKMHIRTH---TLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPDC 339
Fly 340 PRSFADRSNLRAHQQTHVDVKKYACQVC-HKSFSRMSLLN 378 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sna | NP_476732.1 | C2H2 Zn finger | 308..328 | CDD:275368 | 8/19 (42%) |
zf-H2C2_2 | 321..344 | CDD:290200 | 8/22 (36%) | ||
zf-C2H2 | 334..356 | CDD:278523 | 5/21 (24%) | ||
C2H2 Zn finger | 336..356 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 348..373 | CDD:290200 | 9/25 (36%) | ||
C2H2 Zn finger | 364..380 | CDD:275368 | 6/15 (40%) | ||
C2H2 Zn finger | 247..267 | CDD:275368 | 7/22 (32%) | ||
C2H2 Zn finger | 282..302 | CDD:275368 | 8/19 (42%) | ||
zf-C2H2 | 306..328 | CDD:278523 | 8/21 (38%) | ||
COG5048 | 307..>356 | CDD:227381 | 16/48 (33%) | ||
CG10274 | NP_001097525.1 | zf-AD | 15..90 | CDD:214871 | |
C2H2 Zn finger | 334..353 | CDD:275368 | 1/18 (6%) | ||
C2H2 Zn finger | 368..388 | CDD:275368 | 8/19 (42%) | ||
COG5048 | 394..729 | CDD:227381 | 27/74 (36%) | ||
C2H2 Zn finger | 397..417 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 425..445 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 453..474 | CDD:275368 | 6/15 (40%) | ||
C2H2 Zn finger | 482..502 | CDD:275368 | |||
C2H2 Zn finger | 510..530 | CDD:275368 | |||
C2H2 Zn finger | 638..659 | CDD:275368 | |||
C2H2 Zn finger | 667..687 | CDD:275368 | |||
zf-H2C2_2 | 680..704 | CDD:290200 | |||
C2H2 Zn finger | 695..715 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24388 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |