DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sna and scrt

DIOPT Version :9

Sequence 1:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001261390.1 Gene:scrt / 38469 FlyBaseID:FBgn0004880 Length:653 Species:Drosophila melanogaster


Alignment Length:415 Identity:126/415 - (30%)
Similarity:184/415 - (44%) Gaps:91/415 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YKSCPLKKRPIVFVEERLPQTE-------ALALTKDSQF-AQDQPQDLSLKRGRDEETQDY---- 57
            |:...|..:|......|:|..|       .|.|:..:.| ...||..|..::.:.::...:    
  Fly   246 YRPYSLDDKPAHGYRRRVPAEEDLHAAHAILDLSASTAFHPPTQPHQLQQQQQQQQQQHQHHHSQ 310

  Fly    58 -QQPEPKRDYVLNLSKTPERNSSSSSNSCLLSPPVEAQDYLPT-EIHMRGLTAGTTGYTTATPTT 120
             |...|::.:.|.|.:..::.:..:              :||| |.|....:..:.....|..:.
  Fly   311 QQHLAPQQHHYLPLQQQQQQQAHHT--------------HLPTLEAHAHLRSTSSIAELAAAASV 361

  Fly   121 INPFQSAFVMAAGCNPISALWSSYQPHLAAFPSPASSMASPQSVYSYQQMTPPSSPGSD--LETG 183
            :|..:          |.|...|:...|:.:.||..||.:|.| |.:....|..::|..|  |:.|
  Fly   362 VNEQR----------PASNASSASSNHMPSSPSSNSSSSSSQ-VQNENSNTTNTNPDGDGCLQDG 415

  Fly   184 SEPEDLSVRNDIPLPALFHLFDEAKSSSSGASVSSSSGYSYT------------------PAMSA 230
            ..                          ||||.:|:...:||                  ||.:|
  Fly   416 EH--------------------------SGASGASAKTVAYTYEAFFVSDGRSKRKHVADPAAAA 454

  Fly   231 SSASVAANHAKNYRFKCDECQKMYSTSMGLSKHRQFHCPAAECNQEKKTHSCEECGKLYTTIGAL 295
            |  .|.....:..::.|.||.|.|:||..||:|:|.| .:.:....||   |..|||.|.::.||
  Fly   455 S--GVPTPDQQKTKYTCSECGKQYATSSNLSRHKQTH-RSLDSQSAKK---CHTCGKAYVSMPAL 513

  Fly   296 KMHIRTHTLPCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFADRSNLRAHQQTHVDVK 360
            .||:.||.|...|.:|||.||||||||||:|:||||||:.|..|.::||||||||||.|||...|
  Fly   514 AMHLLTHKLSHSCGVCGKLFSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSVDK 578

  Fly   361 KYACQVCHKSFSRMSLLNKHSSSNC 385
            .:.|:.|||:|:..|.||||..|.|
  Fly   579 NFECKRCHKTFALKSYLNKHLESAC 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 15/19 (79%)
zf-H2C2_2 321..344 CDD:290200 13/22 (59%)
zf-C2H2 334..356 CDD:278523 13/21 (62%)
C2H2 Zn finger 336..356 CDD:275368 13/19 (68%)
zf-H2C2_2 348..373 CDD:290200 14/24 (58%)
C2H2 Zn finger 364..380 CDD:275368 8/15 (53%)
C2H2 Zn finger 247..267 CDD:275368 11/19 (58%)
C2H2 Zn finger 282..302 CDD:275368 9/19 (47%)
zf-C2H2 306..328 CDD:278523 15/21 (71%)
COG5048 307..>356 CDD:227381 34/48 (71%)
scrtNP_001261390.1 zf-C2H2 467..489 CDD:278523 11/21 (52%)
C2H2 Zn finger 469..489 CDD:275370 11/19 (58%)
C2H2 Zn finger 500..520 CDD:275368 9/19 (47%)
COG5048 520..>617 CDD:227381 51/84 (61%)
C2H2 Zn finger 526..546 CDD:275368 15/19 (79%)
zf-H2C2_2 539..562 CDD:290200 13/22 (59%)
C2H2 Zn finger 554..574 CDD:275368 13/19 (68%)
zf-C2H2 554..574 CDD:278523 13/19 (68%)
zf-H2C2_2 566..590 CDD:290200 13/23 (57%)
C2H2 Zn finger 582..599 CDD:275368 9/16 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457098
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2462
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D37106at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.