| Sequence 1: | NP_476732.1 | Gene: | sna / 34908 | FlyBaseID: | FBgn0003448 | Length: | 390 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001014498.1 | Gene: | Clamp / 35445 | FlyBaseID: | FBgn0032979 | Length: | 566 | Species: | Drosophila melanogaster |
| Alignment Length: | 238 | Identity: | 67/238 - (28%) |
|---|---|---|---|
| Similarity: | 101/238 - (42%) | Gaps: | 32/238 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 160 SPQSVYSYQQM----TPPSSPGSDLETGSEPEDLSVRNDIPLP----------ALFHLFDEAKSS 210
Fly 211 SSGASVSSSSGYSYTPAMSASSASVAANHAKNYRFKCDECQKMYSTSMGLSKHRQFHCPAAECNQ 275
Fly 276 EKKTHSCEECGKLYTTIGALKMHIRTHT--LPCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPD 338
Fly 339 CPRSFADRSNLRAHQQTHVDVKKYACQVCHKSFSRMSLLNKHS 381 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| sna | NP_476732.1 | C2H2 Zn finger | 308..328 | CDD:275368 | 8/19 (42%) |
| zf-H2C2_2 | 321..344 | CDD:290200 | 10/22 (45%) | ||
| zf-C2H2 | 334..356 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 336..356 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 348..373 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 364..380 | CDD:275368 | 5/15 (33%) | ||
| C2H2 Zn finger | 247..267 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 282..302 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2 | 306..328 | CDD:278523 | 9/21 (43%) | ||
| COG5048 | 307..>356 | CDD:227381 | 20/48 (42%) | ||
| Clamp | NP_001014498.1 | COG5048 | <359..498 | CDD:227381 | 48/153 (31%) |
| C2H2 Zn finger | 367..387 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 379..403 | CDD:290200 | 7/30 (23%) | ||
| C2H2 Zn finger | 395..415 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 407..432 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 423..443 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 435..460 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 451..471 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 464..488 | CDD:290200 | 8/23 (35%) | ||
| COG5048 | 475..>529 | CDD:227381 | 8/22 (36%) | ||
| C2H2 Zn finger | 479..499 | CDD:275368 | 6/18 (33%) | ||
| zf-H2C2_2 | 491..515 | CDD:290200 | 2/6 (33%) | ||
| C2H2 Zn finger | 507..527 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 54 | 1.000 | Inparanoid score | I1809 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.050 | |||||