DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sna and prg

DIOPT Version :9

Sequence 1:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001260253.1 Gene:prg / 34177 FlyBaseID:FBgn0285971 Length:558 Species:Drosophila melanogaster


Alignment Length:221 Identity:64/221 - (28%)
Similarity:90/221 - (40%) Gaps:37/221 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 DLETGSEPEDLSVRNDIPLPALFHLFDEAKSSSSGASVSSSSG----------------YSYTPA 227
            |.|.|...||:    |:||..      :|...::..||::::.                ..:|..
  Fly   166 DEEDGQNGEDV----DMPLGM------DAAQMAAQQSVANNANTTEARPKRAFLCQYCDLGFTLP 220

  Fly   228 MSASSASVAANHAKNYRFKCDECQKMYSTSMGLSKH-RQFHCPAAECNQEKKTHSCEECGKLYTT 291
            .......:|| |..|..:.|:.|.....|...|..| :..|.|       .:.:.|..|.|.:..
  Fly   221 AECQEHELAA-HDPNAPYCCNFCNIKLVTRPALISHIKTLHDP-------DRPYVCAHCRKGFVR 277

  Fly   292 IGALKMHIRTHT--LPCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFADRSNLRAHQQ 354
            ...||.|...||  .|..|.:|.|:|||...|..|:|.|:|.|||.|..|||||.....:..|.:
  Fly   278 RSDLKKHTIVHTGVRPFTCNVCSKSFSRNTNLTKHMRIHSGVKPFVCQQCPRSFQTAVEMMRHTR 342

  Fly   355 THVDVKKYACQVCHKSFSRMSLLNKH 380
            :|.:||.:.|..|..||||...|..|
  Fly   343 SHGEVKAFQCGRCPYSFSRRDKLIAH 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 9/19 (47%)
zf-H2C2_2 321..344 CDD:290200 13/22 (59%)
zf-C2H2 334..356 CDD:278523 8/21 (38%)
C2H2 Zn finger 336..356 CDD:275368 7/19 (37%)
zf-H2C2_2 348..373 CDD:290200 8/24 (33%)
C2H2 Zn finger 364..380 CDD:275368 7/15 (47%)
C2H2 Zn finger 247..267 CDD:275368 5/20 (25%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-C2H2 306..328 CDD:278523 9/21 (43%)
COG5048 307..>356 CDD:227381 21/48 (44%)
prgNP_001260253.1 zf-AD 16..94 CDD:285071
COG5048 <212..340 CDD:227381 41/135 (30%)
C2H2 Zn finger 239..260 CDD:275368 5/20 (25%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
zf-H2C2_2 280..305 CDD:290200 10/24 (42%)
zf-C2H2 294..316 CDD:278523 9/21 (43%)
C2H2 Zn finger 296..316 CDD:275368 9/19 (47%)
zf-H2C2_2 308..331 CDD:290200 12/22 (55%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..372 CDD:275368 8/17 (47%)
C2H2 Zn finger 416..436 CDD:275368
C2H2 Zn finger 443..464 CDD:275368
C2H2 Zn finger 470..490 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.