DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment sna and SNAI3

DIOPT Version :9

Sequence 1:	NP_476732.1	Gene:	sna / 34908	FlyBaseID:	FBgn0003448	Length:	390	Species:	Drosophila melanogaster
Sequence 2:	NP_840101.1	Gene:	SNAI3 / 333929	HGNCID:	18411	Length:	292	Species:	Homo sapiens

Alignment Length:	141	Identity:	90/141 - (63%)
Similarity:	104/141 - (73%)	Gaps:	4/141 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   245 FKCDECQKMYSTSMGLSKHRQFHCPAAECNQEKKTHSCEECGKLYTTIGALKMHIRTHTLPCKCP 309
            |:|..|.|.|.|..||::|||.||..    |..:..:|:.|.|.||::||||||||||||||.|.
Human   152 FECFHCHKPYHTLAGLARHRQLHCHL----QVGRVFTCKYCDKEYTSLGALKMHIRTHTLPCTCK 212

  Fly   310 ICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFADRSNLRAHQQTHVDVKKYACQVCHKSFSRM 374
            |||||||||||||||:||||||||:.|..|.|:||||||||||.|||.|.|||.|:.|.|:||||
Human   213 ICGKAFSRPWLLQGHVRTHTGEKPYACSHCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRM 277

  Fly   375 SLLNKHSSSNC 385
            |||.:|..|.|
Human   278 SLLARHEESGC 288

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
sna	NP_476732.1	C2H2 Zn finger	308..328	CDD:275368	17/19 (89%)
		zf-H2C2_2	321..344	CDD:290200	15/22 (68%)
		zf-C2H2	334..356	CDD:278523	14/21 (67%)
		C2H2 Zn finger	336..356	CDD:275368	14/19 (74%)
		zf-H2C2_2	348..373	CDD:290200	16/24 (67%)
		C2H2 Zn finger	364..380	CDD:275368	10/15 (67%)
		C2H2 Zn finger	247..267	CDD:275368	10/19 (53%)
		C2H2 Zn finger	282..302	CDD:275368	13/19 (68%)
		zf-C2H2	306..328	CDD:278523	18/21 (86%)
		COG5048	307..>356	CDD:227381	38/48 (79%)
SNAI3	NP_840101.1	SNAG domain. /evidence=ECO:0000250	1..20
		C2H2 Zn finger	154..174	CDD:275370	10/19 (53%)
		C2H2 Zn finger	185..205	CDD:275368	13/19 (68%)
		COG5048	<206..>278	CDD:227381	54/71 (76%)
		C2H2 Zn finger	211..231	CDD:275368	17/19 (89%)
		C2H2 Zn finger	239..259	CDD:275368	14/19 (74%)
		C2H2 Zn finger	267..283	CDD:275368	10/15 (67%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	50	1.000	Domainoid score	I11668
eggNOG	1	0.900	-	-		E1_KOG2462
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	220	1.000	Inparanoid score	I3564
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24388
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
User_Submission	0	0.000	Not matched by this tool.
	6	5.920