DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sna and zld

DIOPT Version :9

Sequence 1:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001285466.1 Gene:zld / 32994 FlyBaseID:FBgn0259789 Length:1596 Species:Drosophila melanogaster


Alignment Length:605 Identity:111/605 - (18%)
Similarity:182/605 - (30%) Gaps:265/605 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 QTEALALTKDSQFAQDQPQDLSLKRGRDEETQD---YQQPEPKRDYVLNL----SKTPERNSSSS 81
            |..:.:.:..|..|.::.::..|   ||:|..|   :|..:..:.|:|:.    |.||...|||:
  Fly   844 QDRSHSSSSSSSMATEEAEEQEL---RDQEQADDHLHQHQQASQQYLLSARHYHSSTPNTLSSSN 905

  Fly    82 SNSCLLS---------------------------------PPVEAQDY----------LPTEIHM 103
            :|....|                                 ||: |.||          :||.:|.
  Fly   906 TNPSTPSSNSPHTIYRQEQQGTDFSRTTPPPQPLPPMGMLPPM-AMDYNMLALDMPMPMPTLMHS 969

  Fly   104 RGLTAGTTG-------YTTATPTTINPFQSAFV--MAAGCNPI-SALWSSYQ------------- 145
            ..|...:|.       .||:.|.|:.|.|...|  ..|..:|: ..|...:|             
  Fly   970 NMLQCSSTSTTPLATTITTSMPDTMQPPQQQLVHHYQAVLHPLHQQLGEQHQRQEADHHQQQREL 1034

  Fly   146 -------------------PHLAAFP---SPASSMASPQSVYSYQQMTPPSSPGSDLETGSEPED 188
                               ||.::.|   ||..:|..|.:..:..|:.|           .:|..
  Fly  1035 HQLDQQQQQQQALILADSLPHSSSSPTSSSPPPTMPMPLTTITAPQLLP-----------LQPPP 1088

  Fly   189 LSVRNDIPLPALFHL---------------FD-------------EAKSSSSGASVSSS------ 219
            ..:.:.:|:|...|:               .|             ||.:.::|...|:.      
  Fly  1089 PHITSTMPMPPTMHMPIMPPPPQCYQQLQPLDPTMSYHTIIGSGPEAHTGTAGGGYSNQITTSDG 1153

  Fly   220 -----------------SGYS-------------------------------------------- 223
                             |.||                                            
  Fly  1154 QILQLMPTSLFAPYAPLSPYSVAAQRSPQEGDLPPVHTLTTALHAHQQGGQQEAQTPTLTVLSTP 1218

  Fly   224 YTPAMSASSASVA------------------------------------ANHAKNYRFKCDECQK 252
            |:|.:|:|.|:.|                                    .:|.:..:...|:.|.
  Fly  1219 YSPTVSSSRATPALEMDMATLMQHHQDYEMEQYQMQHQQLDQMQQHQQQLDHQQQQQILADQTQT 1283

  Fly   253 MYSTSMGLSKHRQFHCPAAECNQEKKTHS-----------------CEECGKLYTTIGALKMHIR 300
            |  ....|:|.|:.........:.::..|                 |.||.|.:|....|..|.:
  Fly  1284 M--AQQPLAKKRRGGNATPSTTKRRRNSSVGSTSPHSTTLPSGRIKCLECDKEFTKNCYLTQHNK 1346

  Fly   301 T-HT--LPCKCPICGKAFSRPWLLQGHIRTH-TGEKPFQCPDCPRSFADRSNLRAH-QQTHVDVK 360
            : |:  .|.:|..|||.|....:...|:..| |.:||.:|..||:.|..:::||.| :..|..:|
  Fly  1347 SFHSGEYPFRCQKCGKRFQSEDVYTTHLGRHRTQDKPHKCELCPKQFHHKTDLRRHVEAIHTGLK 1411

  Fly   361 KYACQVCHKSFSRMSLLNKH 380
            ::.|.:|.|.|.|...|.||
  Fly  1412 QHMCDICEKGFCRKDHLRKH 1431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 6/19 (32%)
zf-H2C2_2 321..344 CDD:290200 8/23 (35%)
zf-C2H2 334..356 CDD:278523 7/22 (32%)
C2H2 Zn finger 336..356 CDD:275368 7/20 (35%)
zf-H2C2_2 348..373 CDD:290200 9/25 (36%)
C2H2 Zn finger 364..380 CDD:275368 6/15 (40%)
C2H2 Zn finger 247..267 CDD:275368 6/19 (32%)
C2H2 Zn finger 282..302 CDD:275368 7/20 (35%)
zf-C2H2 306..328 CDD:278523 6/21 (29%)
COG5048 307..>356 CDD:227381 17/50 (34%)
zldNP_001285466.1 zf-C2H2_jaz 552..577 CDD:288983
LIM 1328..1389 CDD:259829 20/60 (33%)
C2H2 Zn finger 1328..1349 CDD:275368 7/20 (35%)
C2H2 Zn finger 1357..1377 CDD:275368 6/19 (32%)
C2H2 Zn finger 1386..1407 CDD:275368 7/20 (35%)
zf-H2C2_2 1398..1422 CDD:290200 8/23 (35%)
zf-C2H2 1413..1435 CDD:278523 8/19 (42%)
C2H2 Zn finger 1415..1435 CDD:275368 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457223
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.