DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sna and CG42726

DIOPT Version :9

Sequence 1:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster


Alignment Length:169 Identity:48/169 - (28%)
Similarity:77/169 - (45%) Gaps:38/169 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 CDECQKMYSTSMGLSKHRQ---------------FHCPAAECNQE-----------------KKT 279
            |.||:...|..:..::..|               :||..  ||::                 .|.
  Fly    38 CLECRVARSVDIQETQETQARTSADKRIIVTDKGYHCTV--CNKDFRSRTQQYYHLTCGNDLLKK 100

  Fly   280 HSCEECGKLYTTIGALKMHIRTHTLPCK--CPICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRS 342
            .:|:|||:.:.|...||.|:.:|....|  |.:|.|:|.:|.:||.|:.||..||.. ||.|.:.
  Fly   101 FNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEKHL-CPICQKV 164

  Fly   343 FADRSNLRAHQQTHVDV-KKYACQVCHKSFSRMSLLNKH 380
            |..:|:|.:|...|.|: .::.|::|.|.|...:.||:|
  Fly   165 FRRKSSLASHLAIHSDLGLQFKCELCSKHFQNKANLNQH 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 8/19 (42%)
zf-H2C2_2 321..344 CDD:290200 10/22 (45%)
zf-C2H2 334..356 CDD:278523 7/21 (33%)
C2H2 Zn finger 336..356 CDD:275368 7/19 (37%)
zf-H2C2_2 348..373 CDD:290200 8/25 (32%)
C2H2 Zn finger 364..380 CDD:275368 6/15 (40%)
C2H2 Zn finger 247..267 CDD:275368 5/34 (15%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-C2H2 306..328 CDD:278523 9/23 (39%)
COG5048 307..>356 CDD:227381 20/50 (40%)
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 3/21 (14%)
C2H2 Zn finger 103..123 CDD:275368 8/19 (42%)
COG5048 <112..288 CDD:227381 34/93 (37%)
C2H2 Zn finger 131..151 CDD:275368 8/19 (42%)
Chordopox_A33R 151..>254 CDD:283591 19/54 (35%)
C2H2 Zn finger 158..178 CDD:275368 7/19 (37%)
C2H2 Zn finger 187..207 CDD:275368 7/17 (41%)
C2H2 Zn finger 216..236 CDD:275368
C2H2 Zn finger 244..264 CDD:275368
C2H2 Zn finger 272..290 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468418
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.