DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sna and klu-1

DIOPT Version :9

Sequence 1:NP_476732.1 Gene:sna / 34908 FlyBaseID:FBgn0003448 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_493611.2 Gene:klu-1 / 173366 WormBaseID:WBGene00013970 Length:543 Species:Caenorhabditis elegans


Alignment Length:321 Identity:86/321 - (26%)
Similarity:125/321 - (38%) Gaps:62/321 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DLSLKRGRDEETQDYQQPEPKRDYVLNLSKTPERNSSSSSNSCLLSPPVEAQDYLPTEIHMRGLT 107
            :||.:|.|.|..   .|| .:.|.|.:|            |:..:|.|:    |....:|..|  
 Worm   182 ELSRERSRSESD---MQP-TQEDDVRHL------------NTSTISVPI----YAKKPLHKFG-- 224

  Fly   108 AGTTGYTTATPTTINPFQSAFVMAAGCNPISALWSSYQPHLAAFPSPASSMASPQSVYSYQQMTP 172
             |....:::||...:..:..........|.|.:  ..:..|....|..||.|..| :::.|..|.
 Worm   225 -GEIKRSSSTPPPTSDEREQVEQRLLLRPSSGM--EIKKDLETTNSFVSSWAREQ-IFAMQNATM 285

  Fly   173 PSSPGSDLETGSEPEDLSVRNDIPLPALFHLFDEAKSSSSGASVSSSSGYSYTPAMSASSASVAA 237
                 .:|.|....||.|.   |..|....:|..:|...:.|....||                 
 Worm   286 -----YNLLTARSAEDCST---ISTPGPLKVFPRSKDDMTFAPRDDSS----------------- 325

  Fly   238 NHAKNYRFKCDECQKMYSTSMGL-----SKHRQFHCPAAECNQEKKTHSCEECGKLYTTIGALKM 297
             .||..::.|..|.:.::....|     |:|||..|...:.:   |.|.|..|.|.::....|..
 Worm   326 -RAKQMQYPCTLCGQAFAVHDRLAKHIASRHRQRSCTLDDAS---KVHKCNMCSKSFSRSDMLTR 386

  Fly   298 HIRTHT--LPCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFADRSNLRAHQQTH 356
            |:|.||  .|..||.|.:.|||...|..|:||||||||:.||.|..|.:.|..:..|.:||
 Worm   387 HMRLHTGAKPYSCPTCNQVFSRSDHLSTHLRTHTGEKPYACPMCNYSASRRDMISRHMRTH 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
snaNP_476732.1 C2H2 Zn finger 308..328 CDD:275368 9/19 (47%)
zf-H2C2_2 321..344 CDD:290200 14/22 (64%)
zf-C2H2 334..356 CDD:278523 6/21 (29%)
C2H2 Zn finger 336..356 CDD:275368 6/19 (32%)
zf-H2C2_2 348..373 CDD:290200 3/9 (33%)
C2H2 Zn finger 364..380 CDD:275368
C2H2 Zn finger 247..267 CDD:275368 7/24 (29%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-C2H2 306..328 CDD:278523 9/21 (43%)
COG5048 307..>356 CDD:227381 22/48 (46%)
klu-1NP_493611.2 C2H2 Zn finger 334..354 CDD:275368 3/19 (16%)
zf-C2H2 369..391 CDD:278523 7/21 (33%)
C2H2 Zn finger 371..391 CDD:275368 6/19 (32%)
zf-H2C2_2 383..408 CDD:290200 10/24 (42%)
COG5048 395..>448 CDD:227381 25/53 (47%)
C2H2 Zn finger 399..419 CDD:275368 9/19 (47%)
zf-H2C2_2 411..436 CDD:290200 14/24 (58%)
C2H2 Zn finger 427..447 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4280
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.